KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090135: AU38_02800Help
Entry
AU38_02800        CDS       T03731                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
sena  Salmonella enterica subsp. enterica serovar Enteritidis EC20090135
Pathway
sena00633  Nitrotoluene degradation
sena01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sena00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AU38_02800
Enzymes [BR:sena01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     AU38_02800
  1.-  
   1.-.-  
    1.-.-.-  
     AU38_02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AHP68549
Structure
PDB: 

Position
complement(608896..609549)
Genome map
AA seq 217 aa AA seqDB search
MDIVSVALQRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYTFNERKMLDASHVVVFCAKTAMDDAWLERVVDQEDADGRFATPEAKAENDKG
RRFFADMHRVSLKDDHQWMAKQVYLNVGNFLLGVAAMGLDAVPIEGFDAEVLDAEFGLKE
KGYTSLVVVPVGHHSVEDFNAGLPKSRLPLETTLTEV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtttctgtcgccttacagcgctactccactaaggcgttcgatcccagcaaa
aaactgaccgccgaagaagcggataaaataaaaacactactacagtacagcccctccagc
accaattcccagccgtggcactttattgtcgccagtacggaagaaggcaaagcgcgcgta
gcaaaatccgctgccggaaactacacgttcaacgaacgcaaaatgctggacgcctcccat
gtggtggtcttctgcgccaaaaccgcaatggatgacgcatggcttgagcgcgtcgtcgat
caggaagatgctgatggccgtttcgctacgccggaagctaaagcggaaaatgataaaggt
cgccgctttttcgccgatatgcaccgcgtctcgctgaaagatgaccaccagtggatggcg
aagcaggtttatctgaacgtcggcaactttctgctgggcgtcgccgcgatgggtctcgac
gccgtccccattgaaggtttcgacgccgaggtgctcgacgctgaatttggtctgaaagaa
aaaggctataccagtctggtcgtggtgccggtcggccatcatagcgtcgaggatttcaac
gccgggctgccgaaatcacgtctgccgcttgaaaccacactgacggaagtttaa

DBGET integrated database retrieval system