KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090135: AU38_03070Help
Entry
AU38_03070        CDS       T03731                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
sena  Salmonella enterica subsp. enterica serovar Enteritidis EC20090135
Brite
KEGG Orthology (KO) [BR:sena00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AU38_03070
Enzymes [BR:sena01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     AU38_03070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AHP68602
Position
665525..666313
Genome map
AA seq 262 aa AA seqDB search
MFVAAGQFVVSSVWEENAQVCVSLMAQAAGRGVSLLVLPEGILARNDIDLDLPIRAAQPL
DGAFMTRLLEESAHNNMTTIFTILVPSTPGRAVNMLVALRAGHIVARYAKLHLYDAFSMQ
ESQSIDAGTVIAPVLDVEGVKVGLMTCYDLRFPDMALALALQGADVLALPTGWVRGPLKE
QQWSTLLAARALDTTCYMIAAGECGNRNIGQSRIIDPLGVTIAAAADRPALIVAEIFRER
IDQVREQLPLLQQRRFAPPQLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttgcagccgggcagtttgtggtgagttctgtatgggaagagaatgcgcaagtt
tgcgtttcgttaatggctcaggcggcgggccgcggcgtatcgcttctggtgttgcctgag
gggatattagcgcgaaatgacatcgaccttgacctgccgattcgcgccgcgcagccgctg
gatggcgcgtttatgacgcggcttctggaagaaagcgctcataataatatgacgacgata
ttcactatccttgtcccgtcaacgcctggacgggcggttaatatgctggtggcgctacgg
gcgggtcacattgtcgcgcgttacgcgaagctgcatctctatgatgcgttttcgatgcaa
gaatcccaaagtattgatgccggaaccgttatcgcgcctgtgctggacgtggagggggtt
aaggtggggcttatgacctgttatgacctgcgctttcctgacatggcgttagcgctggct
ttacagggggctgacgtattggcgctgccgacgggctgggttcgcggcccgttgaaagag
cagcagtggtcgacgctgctggcggcgagagcgctggataccacctgctatatgattgcg
gccggggagtgtggtaatcgtaatattggtcaaagtcgtattatcgatccgttgggggta
acgatagccgcggcagccgatcgtccggcgctgatcgtcgcggaaatattcagagaacga
atagatcaggtgcgggagcaacttcctcttttgcagcaacgacgatttgcgccaccgcaa
ttattatga

DBGET integrated database retrieval system