KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090135: AU38_03550Help
Entry
AU38_03550        CDS       T03731                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sena  Salmonella enterica subsp. enterica serovar Enteritidis EC20090135
Pathway
sena00020  Citrate cycle (TCA cycle)
sena00640  Propanoate metabolism
sena00660  C5-Branched dibasic acid metabolism
sena01100  Metabolic pathways
sena01110  Biosynthesis of secondary metabolites
sena01120  Microbial metabolism in diverse environments
sena01130  Biosynthesis of antibiotics
sena01200  Carbon metabolism
Module
sena_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sena_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AU38_03550
   00640 Propanoate metabolism
    AU38_03550
   00660 C5-Branched dibasic acid metabolism
    AU38_03550
Enzymes [BR:sena01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AU38_03550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AHP68688
Position
766459..767328
Genome map
AA seq 289 aa AA seqDB search
MSVLINKDTKVICQGFTGSQGTFHSEQAIAYGTQMVGGVTPGKGGTTHLGLPVFNTVREA
VEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMI
GPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGG
DPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAP
KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttttaattaataaagataccaaggttatctgccagggcttcaccggtagccag
gggactttccactccgaacaggcgattgcttacggtacgcaaatggtcggcggcgtaacg
ccgggcaaaggcggcaccacgcatctgggtctgccggtgttcaacaccgtgcgcgaagcg
gtagaagccaccggtgcgaccgcatccgttatctacgtgccggcgccgttctgcaaagac
tccattctggaagcgatcgacgcaggcatcaaactgattatcaccatcaccgaaggtatt
ccgacgctggatatgctgaccgtgaaagtgaagctggacgaagcgggcgtacgcatgatc
ggcccgaactgcccaggtgtgatcaccccgggcgaatgcaaaatcggcatcatgccgggt
cacattcataagccgggtaaagtgggtatcgtttcccgttccggcacgctgacctatgaa
gcggttaagcagaccaccgactacggtttcggccagtccacctgcgtgggtatcggcggc
gacccgattccgggctctaacttcatcgacatcctgaaactgttccaggaagatccgcag
actgaagcgatcgtgatgatcggcgagatcggcggtagcgcagaagaagaagcggctgct
tatattaaagaacacgtgaccaagccggttgttggctatatcgcgggtgttaccgcgccg
aaaggcaaacgtatgggccacgctggcgccatcattgccggtggtaaaggcactgcggat
gaaaaattcgccgcgctggaagccgcaggcgtgaaaaccgttcgcagcctggccgatatc
ggcgaagcgctgaaagcaattataaaataa

DBGET integrated database retrieval system