KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090135: AU38_14265Help
Entry
AU38_14265        CDS       T03731                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
sena  Salmonella enterica subsp. enterica serovar Enteritidis EC20090135
Brite
KEGG Orthology (KO) [BR:sena00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sena03016]
    AU38_14265
Enzymes [BR:sena01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AU38_14265
Transfer RNA biogenesis [BR:sena03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    AU38_14265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AHP70715
Position
complement(3004368..3005150)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDPWLVAVNKPAGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGWLMDDAVLDYPLVEERDKIADKFAREDK
APQPAVTQYRGLATVEMAVPTGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFACRRLMLHASRLELTHPFTGQPLMIQAGLDETWMQALTQFGWRGLL
PDNERVEFTAASRQDETHQA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatcctctatcaagacccgtggctggttgccgtgaataaacccgcaggctgg
cttgttcaccggagctggctggatcgcgacgaaaaagtcgtggtcatgcaaacggtgcgc
gaccaaatcggccagcatgtttttaccgcccaccgtctcgacagacccacgtcgggcgta
ctgttaatggggctgtccagcgaagcgggacgccgtctggcgcagcagttcgagcagcac
cacatccgtaaacgctaccatgccattgtgcgcggctggctgatggatgacgcggtactg
gattatccgctggtggaagagcgcgataaaattgccgataaattcgcccgcgaagataaa
gcgccccagccggctgtaacgcagtatcgcggactggcgacggtcgaaatggcggtaccg
accgggcgttatcccaccacgcgttatggtctggttgagctagaaccaaaaacgggacgt
aagcaccagctccgtcgtcatctggcgcatctgcgtcatcctatcatcggcgacagtaaa
catggcgatttgcgacaaaaccgcagcgccgcagagcattttgcctgtcgtcgcctgatg
cttcatgccagtcggcttgagctgacgcaccccttcaccggacagccgttgatgattcag
gccgggttggatgaaacctggatgcaggcgctgacacagtttggctggcgtggacttctc
cctgacaatgaaagggttgagtttacggcggcgtcccggcaggatgagactcatcaggca
taa

DBGET integrated database retrieval system