KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_30840Help
Entry
BN855_30840       CDS       T02827                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb00071  Fatty acid degradation
senb00280  Valine, leucine and isoleucine degradation
senb00310  Lysine degradation
senb00362  Benzoate degradation
senb00380  Tryptophan metabolism
senb00620  Pyruvate metabolism
senb00630  Glyoxylate and dicarboxylate metabolism
senb00640  Propanoate metabolism
senb00650  Butanoate metabolism
senb00900  Terpenoid backbone biosynthesis
senb01100  Metabolic pathways
senb01110  Biosynthesis of secondary metabolites
senb01120  Microbial metabolism in diverse environments
senb01130  Biosynthesis of antibiotics
senb01200  Carbon metabolism
senb01212  Fatty acid metabolism
senb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:senb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN855_30840
   00630 Glyoxylate and dicarboxylate metabolism
    BN855_30840
   00640 Propanoate metabolism
    BN855_30840
   00650 Butanoate metabolism
    BN855_30840
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN855_30840
   00072 Synthesis and degradation of ketone bodies
    BN855_30840
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN855_30840
   00310 Lysine degradation
    BN855_30840
   00380 Tryptophan metabolism
    BN855_30840
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN855_30840
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN855_30840
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN855_30840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senb04147]
    BN855_30840
Enzymes [BR:senb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN855_30840
Exosome [BR:senb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN855_30840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CDF55264
Position
complement(3067505..3068683)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gctattaccattaatgacgtttgtggttccggtttaaaagcgttgcacttggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccggacgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system