KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_36260Help
Entry
BN855_36260       CDS       T02827                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb00430  Taurine and hypotaurine metabolism
senb00460  Cyanoamino acid metabolism
senb00480  Glutathione metabolism
senb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BN855_36260 (ggt)
   00460 Cyanoamino acid metabolism
    BN855_36260 (ggt)
   00480 Glutathione metabolism
    BN855_36260 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:senb01002]
    BN855_36260 (ggt)
Enzymes [BR:senb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BN855_36260 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BN855_36260 (ggt)
Peptidases and inhibitors [BR:senb01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BN855_36260 (ggt)
CD molecules [BR:senb04090]
 Proteins
  BN855_36260 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: CDF55807
Position
complement(3591595..3593337)
Genome map
AA seq 580 aa AA seqDB search
MKPTFMRWVAIAALLAGGTFSAVANPPVAPPVSYGVEEDVFHPVRATQGMVASVDAMATQ
VGVDILKQGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLLRTKDGNTTAIDFREMAPAA
ATRDMFLDDQGNADAKKSLTSHLASGTPGTVAGFSLALEKYGTMPLNKVVRPAMKLAEEG
FVVNDALADDLKTYGSEVIPNHENSKAIFWKDGEPLKKGDKLVQKNLAKSLEMIAENGPD
AFYKGAIADQIAGEMHKNGGLMTKEDLASYKAVERTPISGDYRGYQVFSMPPPSSGGIHI
VQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRSEYLGDPDFVKVPWQALTHKAYA
KTLADQIDINKAKPSSQIKPGKLAPYESNQTTHFSVVDKDGNAVAVTYTLNTTFGTGIVA
GNTGILLNNQMDDFSAKPGVPNVYGLVGGDANAVGPKKRPLSSMSPTIVVKEGKTWLVTG
SPGGSRIITTVLQMVVNSIDFGMNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEQK
GQKVALKEAMGSTQSIMVGPDGELYGASDPRSVDDLTAGY
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaacgtttatgcgctgggtggcgatcgccgctctgctggccggggggacgttt
agcgcggtggccaatcctcccgtcgcgccgccagtctcctatggtgttgaagaagatgtc
tttcatcctgtacgggcgacgcaagggatggtggcgtccgtggatgcaatggcgacgcag
gttggcgtggatatcttaaagcagggcggtaatgccgtggatgccgccgtcgccgtgggc
tatgcgctggcggtgacgcatccgcaggcgggtaatctgggcggtggtggttttatgctg
ctgcgtaccaaagacggtaacacgacggcgattgattttcgtgaaatggcgcctgctgcc
gcgacccgtgatatgttcctcgacgatcagggtaacgccgatgcgaaaaagtcgctgacg
tcgcatctggcatccggtacgccgggtaccgtggcggggttctcgctggcgctggagaaa
tacggcacgatgccgctgaataaagtggtgcgtccggcgatgaagctggcggaagagggt
tttgtggttaacgatgcgctggctgacgacttaaaaacttacggcagcgaagtgatcccc
aaccatgagaacagcaaagccattttctggaaagacggcgagccgctgaaaaaaggcgat
aagctggtccagaagaatctggcgaaaagcctggaaatgattgccgaaaacggcccggat
gcgttttataaaggggcgattgccgaccagattgccggggaaatgcacaagaacggcggt
ctgatgaccaaagaggatttagccagctataaagccgttgagcgtacgccaatcagcggt
gactatcgcgggtatcaggtcttctccatgccgccgccatcctcgggcggtattcacatc
gtacagatccttaatattcttgaaaacttcgacatgaagaagtacggctttggcagcgcc
gatgccatgcaaatcatggcggaagcggaaaaatacgcctacgctgaccgctcagagtat
ctgggcgatccggactttgtgaaagtgccgtggcaggcgctgacccacaaagcctatgcg
aaaacgctggccgatcaaattgatatcaacaaggccaaaccttccagccagataaaaccg
ggcaagctcgccccgtatgaaagcaaccagaccacccacttctcggtggtggataaagac
ggcaatgctgtggcggtgacctataccctgaacaccaccttcggcacaggaattgtggcg
ggaaataccggtattctgctgaataatcaaatggatgatttttctgctaaacccggtgta
cctaatgtttatggcctggtgggcggcgatgctaacgcggtcggtccgaagaagcgtccg
ctgtcgtcgatgtcgcccactatcgtcgttaaagagggcaaaacctggctggtgaccggc
agtcctggcgggagtcgaatcatcactaccgtgctgcaaatggtagtgaacagcattgat
tttggcatgaacgtcgccgaagcgaccaacgcgccgcgtttccatcatcaatggttgccg
gacgaactgcgggtagaaaagggcttcagccccgatacgctgaagttactggaacagaaa
gggcagaaagtcgcgctgaaagaagcgatgggcagcacccaaagtattatggttggaccg
gatggcgaactgtatggcgcgtctgacccgcgttcggtggatgatttaacggcgggatac
tga

DBGET integrated database retrieval system