KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_41330Help
Entry
BN855_41330       CDS       T02827                                 

Definition
(GenBank) sensor protein CpxA
  KO
K07640  two-component system, OmpR family, sensor histidine kinase CpxA [EC:2.7.13.3]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb01503  Cationic antimicrobial peptide (CAMP) resistance
senb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:senb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN855_41330
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN855_41330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:senb01001]
    BN855_41330
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:senb02022]
    BN855_41330
Enzymes [BR:senb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BN855_41330
Protein kinases [BR:senb01001]
 Histidine kinases
  OmpR family
   BN855_41330
Two-component system [BR:senb02022]
 OmpR family
  CpxA-CpxR (envelope stress response)
   BN855_41330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA CpxA_peri HAMP HATPase_c_3 HATPase_c_2 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: CDF56314
Position
complement(4118177..4119550)
Genome map
AA seq 457 aa AA seqDB search
MIGSLTARIFAIFWLTLALVLMLVLMLPKLDSRQMTELLDSEQRQGLMIEQHVEAELAND
PPNDLMWWRRLFRAIDKWAPPGQRLLLVTSEGRVIGAERSEMQIIRNFIGQADNADHPQK
KKYGRVEMVGPFSVRDGEDNYQLYLIRPASSSQSDFINLLFDRPLLLLIVTMLVSSPLLL
WLAWSLAKPARKLKNAADEVAQGNLRQHPELEAGPQEFLAAGASFNQMVTALERMMTSQQ
RLLSDISHELRTPLTRLQLGTALLRRRGGESKELERIETEAQRLDSMINDLLVMSRNQQK
NALVSETMKANQLWGEVLDNAAFEAEQMGKSLTVNYPPGPWPLYGNPNALESALENIVRN
ALRYSHTKIEVGFSVDKDGITITVDDDGPGVSPEDREQIFRPFYRTDEARDRESGGTGLG
LAIVESAMQQHRGWVKADDSPLGGLRLTLWLPLYKRT
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgataggaagtttaaccgcgcgcatcttcgccatcttctggttgacgctggcgctggtg
ctaatgctggtactgatgttgcccaagctcgattcacgccagatgaccgagctgctggac
agcgaacagcgccagggattgatgatagagcaacatgtagaagctgaacttgcgaacgat
ccgcccaacgacctgatgtggtggcgtcgcctgttccgcgcgatcgataagtgggcgccg
cctggacagcggttattactggtgacctctgaaggacgcgtgatcggcgctgaacgcagc
gaaatgcagatcattcgtaacttcattggtcaggcggataacgccgatcatccgcagaag
aaaaaatatggccgcgtagagatggtggggccgttctccgttcgtgacggagaggataat
taccagctttacctgattcgaccggccagcagttcgcaatccgattttattaatctgctg
tttgaccgcccgctcctgttgctcattgtcacgatgctggtcagttcgccgctcttgcta
tggctggcatggagtctggcgaaaccggcgcgtaagttgaaaaacgcggctgatgaagtg
gcgcaaggcaacctgcgtcagcatccggagctggaggcgggtccgcaggagttcctcgcc
gctggcgccagttttaaccagatggtgacggcgctggaacggatgatgacctcgcagcag
cgtttgctgtcagacatctcccatgagctgcgaacgccccttacgcgcctgcaactgggt
accgcgctgctgcgtcgtcgtggcggcgaaagcaaagagctggagcgtattgaaaccgaa
gcgcagcgtctggacagcatgatcaatgacctgctggtgatgtcgcgtaaccaacagaaa
aatgcgctggtcagcgaaacgatgaaagccaatcagctatggggcgaagtgctggataac
gccgcctttgaagccgaacagatgggcaagtcgttaacggtaaattatccgccggggccg
tggccgctctatggcaacccaaacgcgctggaaagcgcgctggaaaatattgttcgtaat
gcgctgcgctattcacatacgaagattgaagtcggcttctcggtggataaagacggtatt
acgatcacggtcgatgacgacgggccgggcgtcagccctgaagaccgcgagcagatcttc
cgtccgttctatcgcactgatgaggcgcgcgaccgcgagtctggcggcaccgggctgggg
ctggcgattgtcgaaagcgccatgcagcagcaccgcggctgggtgaaggctgacgatagc
ccgctcggcgggttgcggcttacgctgtggctaccgctgtacaagcgaacctaa

DBGET integrated database retrieval system