KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_46530Help
Entry
BN855_46530       CDS       T02827                                 

Definition
(GenBank) hypothetical protein
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb00760  Nicotinate and nicotinamide metabolism
senb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BN855_46530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:senb03000]
    BN855_46530
Enzymes [BR:senb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     BN855_46530
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     BN855_46530
Transcription factors [BR:senb03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    BN855_46530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 Citrate_ly_lig CTP_transf_like MMR_HSR1 HTH_3 ABC_tran AAA_29 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: CDF56834
Position
4658638..4659792
Genome map
AA seq 384 aa AA seqDB search
MTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFPRRQKNIGVVFGKFYPLHTGHIYLIQR
ACSQVDELHIIMGYDDTRDRGLFEDSAMSQQPTVSDRLRWLLQTFKYQKNIRIHAFNEEG
MEPYPHGWDVWSNGIKAFMAEKGIQPSWIYTSEEADAPQYLEHLGIETVLVDPERTFMNI
SGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRD
YVFSHLGGDEMALQYSDYDKIALGHAQYIDFSVKYANKVAFIDTDFVTTQAFCKKYEGRE
HPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKAFQSLLVEMLKENNIEFVHV
KEADYDGRFLRCVELVKEMMGEQG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggggtatctgagtcagttacttaacgccaaaatcaaaagccccagcgcgcaa
aaactggaggcgctacaccgttttctcgggctggagtttccccgccgacagaaaaacatt
ggcgtggtgttcggtaaattttatccattgcataccggacacatctacttgatccagcgc
gcctgtagccaggtggatgagttgcatatcattatgggatatgacgatacgcgcgaccgc
gggctgtttgaggatagcgccatgtcgcagcagcccaccgtgtcggatcgcctgcgctgg
ttgctgcaaaccttcaaataccaaaaaaatattcgcatccacgcctttaatgaagagggg
atggagccttatccgcatggctgggacgtctggagcaacggcattaaagcgtttatggca
gagaagggaatacagccgagctggatctacacttccgaagaggctgatgcgccgcagtac
cttgagcatttagggattgagacggtgctggtcgatcctgaacgcacgtttatgaatatc
agcggggcgcaaatccgcgaaaatccgtttcgttactgggaatatattcctaccgaagtg
aagccgtttttcgtgcgtaccgtcgcgattctgggcggggaatcaagcggcaagtctacg
ctggtcaataagctcgccaatatttttaataccaccagcgcctgggaatatggccgcgac
tatgtcttttcgcatctgggcggcgatgagatggcgttacagtattccgactacgataaa
atcgcgctgggtcatgcgcaatatattgatttctcagtaaaatatgcgaataaagtggcg
tttatcgataccgatttcgtcaccacccaggcattttgcaaaaaatacgaagggcgcgag
catccctttgtccaggcgctgatcgacgagtatcgcttcgacctggtgattttgctggag
aataatacgccgtgggtagctgacggactgcgaagcctgggcagttcagtggatcgcaaa
gcgttccagagcctgttggtcgagatgctgaaagagaacaacattgagttcgttcacgtt
aaagaggctgactacgatggccgctttttgcgctgtgtggaactggtgaaagagatgatg
ggcgagcagggataa

DBGET integrated database retrieval system