KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_7390Help
Entry
BN855_7390        CDS       T02827                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase alpha chain; flags fragment
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb00620  Pyruvate metabolism
senb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN855_7390 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:senb02000]
    BN855_7390 (oadA)
Enzymes [BR:senb01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BN855_7390 (oadA)
Transporters [BR:senb02000]
 Other transporters
  Primary active transporters [TC:3]
   BN855_7390 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA
Motif
Other DBs
NCBI-ProteinID: CDF52915
Position
773530..775167
Genome map
AA seq 545 aa AA seqDB search
MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAALDDVGYGSLECWGGATFDACIRFLGED
PWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMKAALSAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAYELVSEIKKRYDVRLHLHCHATTGMAEMALLKAIEAGIDGVDTAISSMSATYGHPA
TEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEGQLKGYDSRILVAQVPGGML
TNLESQLKQQNAADKLDQVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQARVLDGGAPVTCRPADLLKPELAELEADVRRQAQEK
GITLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPLPQAEAAQPVAKAEKPAASGIYT
VEVEGKAFVVKVSDGGDISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRWRRTRI
WRWCR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgactattgccattaccgatgtcgtcctgcgcgacgctcaccagtctctgttcgccacc
cgtctgcgccttgatgacatgctgccgattgccgctgcgctcgatgacgtgggctacggg
tcgctggagtgctggggcggcgccacctttgacgcctgtatccgctttctcggcgaagac
ccgtggctgcgcctgcgcgaactcaaaaaagccatgccgaaaaccccgctgcagatgctg
ctgcgcggccagaacctgctcggttatcgccactatgccgatgacgtggtggagcgtttt
gttgaacgcgcggtgaaaaacggcatggacgtgttccgcgtcttcgacgccatgaacgac
ccgcgcaatatgaaagcggcgctcagcgcggtgcgcagccacggcgcgcacgcccagggt
acactctcctacaccaccagcccggcgcacacgctgcagacctggctggatttaacggag
caactgctggaaaccggcgttgactcgattgccatcaaggatatgtccggcattctcacg
ccgatggcggcgtatgaactggtcagcgaaatcaaaaaacgctacgacgtgcgcctgcat
ctgcactgccatgccaccaccggcatggcggaaatggcgctgctgaaagccattgaagcg
ggcatcgacggcgtggacacggcgatttcctccatgagcgccacctacggccacccggcc
accgaggcgctggtcgccacgctcgccggtactgagcatgacaccgggctggatatcctg
aagctggaaaatatcgccgcgtacttccgcgaggtgcgcaaaaaatatcacgcctttgaa
ggccagttgaaaggctacgacagccgtattctggtggcgcaggtaccgggcgggatgctc
accaacctcgaaagccagctgaagcagcagaacgcggcggacaaactcgaccaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggttttatcccgctggtgacccccacctcg
cagattgtcggcacccaggcggtgctcaacgtgctgaccggcgagcgctacaaaaccatt
gccaaagaaacggccggcattctgaaaggcgaatacggccacaccccggtgccggtgaac
gctgcgttacaggcccgcgtgctggacgggggcgctccggtgacctgccgcccggcggac
ctgctgaagccggagctggctgaactggaagcggacgtcaggcgccaggcgcaggagaag
ggcatcactctggcgggaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
atcggcctcaaattcctcgaaaaccgccacaacccggcggcgtttgagccactgccgcag
gcggaagccgcgcagccggtggcaaaagcagagaagcctgcagcttccggtatctacacc
gtggaagtggaaggcaaagcctttgtggtgaaggtcagcgacggcggcgatatcagccan
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncggtggcggcgtactcgtata
tggcgctggtgccgttaa

DBGET integrated database retrieval system