KEGG   Salmonella enterica subsp. enterica serovar Tennessee: SEET0819_02030Help
Entry
SEET0819_02030    CDS       T03730                                 

Gene name
glyS
Definition
(GenBank) glycyl-tRNA ligase
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
senc  Salmonella enterica subsp. enterica serovar Tennessee
Pathway
senc00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:senc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SEET0819_02030 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:senc01007]
    SEET0819_02030 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:senc03016]
    SEET0819_02030 (glyS)
Enzymes [BR:senc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     SEET0819_02030 (glyS)
Amino acid related enzymes [BR:senc01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   SEET0819_02030 (glyS)
Transfer RNA biogenesis [BR:senc03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SEET0819_02030 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AHN78034
Position
complement(430414..432483)
Genome map
AA seq 689 aa AA seqDB search
MSEKTFLVEIGTEELPPKALRSLAESFAVNFTAELDNAGLAHGNVEWFAAPRRLALKVAN
LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTDKGEWLLYRA
HVKGESTEALVPNMVATSLAKLPIPKLMRWGASDVHFVRPVHTVTLLLGDKVIPATILGI
QSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKADAEEAARKIGGN
ADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYDNAGKLLPN
FIFVANIESKDPQQIISGNEKVVRPRLADAEFFFNTDRKKRLEDHLPRLQTVLFQQQLGT
LRDKTDRIQALAGWIAGQIGADVNHATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHD
GEAEDVAVALNEQYQPRFAGDDLPSNPVACALAIADKMDTLAGIFGIGQHPKGDKDPFAL
RRAALGVLRIIVEKNLNLDLQTLTEEAVRLYDDKLTNANVVDDVIDFMLGRFRAWYQDEG
YTVDTIQAVLARRPTRPADFDARMKAVSHFRTLEEASALAAANKRVSNILAKATEPLNDI
VHASVLKEAAEIELARHLVVLRDKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAE
EKDIRINRLTLLSKLRELFLQVADISLLQ
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacttttctggtggaaatcggcactgaagagctgccaccaaaagcactg
cgcagtttggctgagtcctttgctgtgaacttcactgcggagctggataacgccggcctc
gcgcacggtaacgttgaatggtttgccgccccgcgccgtctggcgctgaaagtggcgaat
cttgctgaatctcagcccgatcgcgaagtcgaaaaacgtggtccggcgattgctcaggcg
ttcgacgccgaaggcaaaccgagcaaagcggcagaaggctgggcgcgcggctgcgggatc
accgttgatcaggccgagcgtctgaagaccgacaaaggcgaatggctgctgtatcgtgcc
cacgtgaagggcgaaagcaccgaagctctggtgccgaacatggtagccacctcgctggcg
aaactaccgatcccgaaactgatgcgctggggcgcgtctgacgtccacttcgtgcgtccg
gtgcacactgtgactctgctactgggcgataaagtgattccggcgaccatcctgggcatt
cagtctgaccgcgtcattcgcggccaccgctttatgggtgagccggagtttactatcgac
aatgctgaccagtacccgcaaattctgctggagcgcggtaaagtcattgcggactacgaa
gcgcgtaaagccaaaatcaaagcggacgccgaagaagcagcacgcaagattggcggtaat
gccgacctgagcgaaagcctgctggaagaagtggcctcgctggtggaatggccggtggta
ttgacggcgaagtttgaagagaaattcctcgccgtgcctgccgaagcgctggtgtacacc
atgaagggcgaccagaagtatttcccggtttatgacaacgcgggcaagctgctgccgaac
tttatcttcgtcgccaacatcgagtcgaaggatccgcaacaaattatctccggtaacgag
aaagtggtgcgtccgcgtctggcagatgctgaattcttcttcaataccgaccgtaaaaaa
cgtctggaagaccatctgccgcgtctgcaaaccgtgttgttccagcaacaactgggcacg
ctgcgcgacaagaccgaccgtattcaggcgctggcgggctggattgctggtcagattggc
gctgacgtcaaccacgccactcgtgcgggcctgctctccaagtgcgacctgatgaccaac
atggtcttcgagttcaccgacacccagggcgtgatggggatgcactacgcgcgtcacgat
ggtgaagcggaagatgtcgcggtggcgctgaacgaacagtatcagccgcgctttgccggt
gatgacctgccgtctaacccggtggcctgcgcgttggcgatcgccgataagatggacact
ctagcgggtatcttcggtatcggccagcatccgaaaggtgacaaagacccgtttgcgctg
cgtcgtgccgcgctgggcgtgctgcgcatcatcgttgagaagaacctcaaccttgatctg
caaacgctgaccgaggaagcggtgcgtctgtatgacgacaagctgaccaatgccaacgta
gtcgatgatgtcatcgattttatgctgggtcgcttccgcgcctggtatcaggacgaaggt
tacaccgtcgacactatccaggcggtactggcgcgtcgtccgacccgtccggcagatttc
gatgctcgtatgaaagcggtatcgcacttccgtaccctggaagaagcctctgcgctggcg
gcggcgaacaagcgcgtctccaacatcctggcgaaagccactgagccgctgaacgatatc
gtccacgcctccgtactgaaagaagcggcggaaattgagttggccagacatctggttgtg
ctgcgtgataagcttcagccgtactttgccgatggtcgttatcaggaagcgttgattgag
ctggctgctctgcgcgcgccggtggatgaattcttcgaaaatgtcatggttaacgcggaa
gagaaagatatccgtatcaaccgcctgacgctgttgtcgaaactacgcgaactgttcctg
caggttgcggatatttcgttactacaataa

DBGET integrated database retrieval system