KEGG   Salmonella enterica subsp. enterica serovar Tennessee: SEET0819_09220Help
Entry
SEET0819_09220    CDS       T03730                                 

Definition
(GenBank) molecular chaperone
  KO
K03770  peptidyl-prolyl cis-trans isomerase D [EC:5.2.1.8]
Organism
senc  Salmonella enterica subsp. enterica serovar Tennessee
Brite
KEGG Orthology (KO) [BR:senc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:senc03110]
    SEET0819_09220
Enzymes [BR:senc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SEET0819_09220
Chaperones and folding catalysts [BR:senc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    SEET0819_09220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurA_N_3 SurA_N_2 Rotamase_2 Rotamase_3 Rotamase SurA_N DUF4214 NDUF_C2
Motif
Other DBs
NCBI-ProteinID: AHN79367
Position
1982698..1984569
Genome map
AA seq 623 aa AA seqDB search
MMDSLRTAANSLVLKIIFVIIIVSFILTGVSGYLIGGSNNYAAKVNGQEISRAQFENAFN
NERNRMQQQLGDRYSELAANEGYMKSLRQQVLNRLIDEALLDQYSRELKLGISDEQVKQA
IFATPAFQVDGKFDNNRYNAIVNQMGMTADQYAQALRNQLTTQQLINGVAGTDFMLKGET
DELAALVSQQRVVREAVIDVNALAAKQLVTDQEVSSYYDQNKVRFMTPEQFRVSYIKLDA
ATMQAPVSDADIQAYYDQHVDQFTQPERIRYSIIQTKTEDDAKAVLDALNKGEDFATLAK
EKSTDIISARNGGDMGWLEESATVPELKNAGLKEKGQISGVIKSSVGFLVARLDDIQPAK
VKPLSEVRDDIAAKVKQEKALDAYYALQQKVSDAASNDNESLAGAEQVAGVKAVETGWFS
HDTLPEELNFKPVADAIFNGGLVGENGTPGLNSDIITVDGDRAFVVRVSEHKPEAVKPLA
EVKEQVTALVKHNKAEQQAKLDAEKLLVELKAGKGAEAMKAAGLSFGEPKTLSRTSQDPV
SQAAFALSLPTKDKPVYGVANDMQGNVVLLAFDEVKAGAMPEAQKKAMVQGITQNNAQIV
FEALMSNLRKEAKIKIGDALEQQ
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgatggacagcttacgcacggctgcaaacagtctcgtgctcaagattattttcgttatc
attatcgtgtcgttcattttgaccggcgttagtggttacctgattggcggaagcaataac
tacgccgcaaaagtgaatggccaggaaatcagccgggcacagtttgagaatgcgtttaat
aacgaacgtaaccgtatgcagcagcagttgggcgacaggtattctgaactggcggccaac
gaaggttatatgaaaagcctgcgccagcaggtgctgaatcgtctgatagatgaagcgctg
ttggatcaatattcccgcgaactgaaactgggcatcagcgatgagcaggtaaagcaggcg
attttcgccactcccgcttttcaggtggacggtaagtttgacaacaaccgctataacgcg
attgtgaatcagatgggaatgaccgccgatcagtacgctcaggcgctgcgtaaccagctt
accactcagcaactgatcaacggcgtggccggtactgattttatgctgaaaggggaaacc
gacgaactggcggcattagtctctcaacagcgcgtggtgcgtgaagccgttattgatgtc
aacgcgctggcggcgaagcagctggtaaccgatcaggaagtgtccagctactacgatcag
aataaagtccgctttatgacgccggaacagttccgcgtaagctatatcaagctggatgcc
gcgacgatgcaggcaccggtcagcgatgcggatattcaggcctattatgaccagcatgta
gatcagtttactcagccggagcgtattcgttacagcattattcagaccaaaacggaagat
gatgcgaaagcggtactggatgcgctgaacaagggcgaagatttcgccacgctggcgaaa
gagaaatctaccgatatcatctctgcgcgtaatggcggcgatatgggctggctggaagag
tctgccacggtgccggaactgaaaaacgccggattaaaagaaaaaggccagatatctggc
gtgattaagtcgtctgtcggttttctggtggcgcgtctggatgatattcagcctgccaaa
gtgaaaccgttaagcgaggttcgcgacgacattgccgcgaaagtgaaacaagaaaaagcg
ctggatgcttactatgcgttgcagcagaaggtgagcgatgcggcaagcaacgacaatgag
tcgttagcaggcgctgaacaggtcgctggcgtaaaagccgttgaaaccggctggtttagt
catgacaccttaccggaagagctgaacttcaaaccggtagccgatgctatctttaatggc
ggcctggtaggcgaaaacggtacgccggggctgaattcagacattatcaccgtagatggc
gaccgggcttttgttgtgcgcgtgagcgaacataaacctgaagccgtgaagccgttggca
gaagtgaaagaacaggtcactgccctggtgaagcataacaaagcggaacaacaggcgaag
ctggatgcggaaaaactgctggtcgagctgaaagcgggcaaaggcgcggaagcgatgaaa
gcggcgggtctgagttttggcgagcctaaaacgttaagtcgtaccagtcaggatccggtg
agtcaggcggcctttgcgttaagccttccgacgaaagataagccagtttatggcgtggcg
aacgatatgcagggtaacgtcgttctgctggcgtttgacgaggtgaaagcgggcgccatg
ccggaagcgcagaaaaaagcgatggtgcagggcatcacgcagaacaatgcgcaaattgtc
tttgaggcgctgatgagcaatctgcgtaaagaggcgaaaatcaaaatcggcgacgctctg
gaacagcagtaa

DBGET integrated database retrieval system