KEGG   Salmonella enterica subsp. enterica serovar Tennessee: SEET0819_21965Help
Entry
SEET0819_21965    CDS       T03730                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
senc  Salmonella enterica subsp. enterica serovar Tennessee
Pathway
senc00071  Fatty acid degradation
senc00280  Valine, leucine and isoleucine degradation
senc00310  Lysine degradation
senc00362  Benzoate degradation
senc00380  Tryptophan metabolism
senc00620  Pyruvate metabolism
senc00630  Glyoxylate and dicarboxylate metabolism
senc00640  Propanoate metabolism
senc00650  Butanoate metabolism
senc00900  Terpenoid backbone biosynthesis
senc01100  Metabolic pathways
senc01110  Biosynthesis of secondary metabolites
senc01120  Microbial metabolism in diverse environments
senc01130  Biosynthesis of antibiotics
senc01200  Carbon metabolism
senc01212  Fatty acid metabolism
senc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:senc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEET0819_21965
   00630 Glyoxylate and dicarboxylate metabolism
    SEET0819_21965
   00640 Propanoate metabolism
    SEET0819_21965
   00650 Butanoate metabolism
    SEET0819_21965
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SEET0819_21965
   00072 Synthesis and degradation of ketone bodies
    SEET0819_21965
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SEET0819_21965
   00310 Lysine degradation
    SEET0819_21965
   00380 Tryptophan metabolism
    SEET0819_21965
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SEET0819_21965
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SEET0819_21965
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SEET0819_21965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senc04147]
    SEET0819_21965
Enzymes [BR:senc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SEET0819_21965
Exosome [BR:senc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SEET0819_21965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHN81767
Position
complement(4585482..4586660)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADTSAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagtatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtactgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gctattaccattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgctgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacaccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaattgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcctattggcgcttccggctgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgtaaaggcctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgattga

DBGET integrated database retrieval system