KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_00931Help
Entry
DT104_00931       CDS       T02874                                 

Gene name
apaG
Definition
(GenBank) CorD protein
  KO
K06195  ApaG protein
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Brite
KEGG Orthology (KO) [BR:send00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DT104_00931 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: CCW72816
UniProt: A0A0U1JHN0
Position
complement(102286..102663)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDENGDAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgcccagagtgtgtattcaggtgcaaagcgtctacattgaggcgcaatcc
tcacctgacgatgaacgttacgtttttgcctataccgtaaccatccgcaatctgggccgg
gcgccagtgcagctattgggccgctactggctgattaccaatggtcatggccgtgaaacc
gaagtccagggcgaaggtgtggttggcgtccagccgcgcattgcgcctggcgaagagtac
cagtacaccagcggcgcggtaattgaaacgccgctgggcaccatgcagggtcattacgaa
atgatcgatgaaaatggcgacgcctttaccatcgacatccccgtgtttcgactcgccgtc
cctacactcattcactaa

DBGET integrated database retrieval system