KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_01681Help
Entry
DT104_01681       CDS       T02874                                 

Gene name
pdxA
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Brite
KEGG Orthology (KO) [BR:send00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DT104_01681 (pdxA)
Enzymes [BR:send01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     DT104_01681 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     DT104_01681 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: CCW72887
UniProt: A0A0U1IGR5
Structure
PDB: 

Position
192415..193398
Genome map
AA seq 327 aa AA seqDB search
METKTVAITMGDPAGIGPEIIVKALSEDGLNGAPLVVIGCLATLKRLQAKGITPNVELRA
IERVAEARFAPGIIHVIDEPLAQPEALEAGKVQAQAGDLAYRCVKRATELALRGDVQAIA
TAPLNKEALHLAGHNYPGHTELLATLTHSRDYAMVLYTDKLKVIHVSTHIALRKFLDTLS
TARVETVIGIADTFLKRVGYVKPRIAVAGVNPHAGENGLFGDEETRILTPAITDARAKGM
DVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLKLLGFYDGVNITAGLPFIRTSADHG
TAFDIAWTGKAKSESMAVSIKLAMQLA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtggagactaaaaccgttgccattaccatgggcgatccagcgggcattgggccggaaatt
attgttaaagcgctaagcgaagacggtctcaacggcgcgccgctggtggttattggatgc
ctcgcaacgttgaaacgtttacaggcgaagggcatcacgccgaacgtcgagttacgggcc
attgaacgggtcgccgaagcgcgttttgcgcccggcatcattcatgtgattgatgagccg
ctggcgcagccggaggcgctggaggccgggaaagttcaggcgcaggcgggggatttagcg
tatcgctgcgtgaagcgcgccaccgagttagcgttacggggcgacgtacaggctatcgct
accgcgccgctgaataaagaggcgctgcacctggcggggcacaactatccgggccatacc
gagctgctcgcgaccctgacccatagccgcgattacgcgatggtactttacaccgataaa
ctaaaagtgattcacgtttcaacgcatatcgcgctgcgtaaattccttgatacgttaagt
accgcgcgtgtcgaaacggtgattggcattgctgatactttcctcaagcgtgtgggttac
gttaaaccgcgtatcgccgtggcaggcgtgaatcctcatgcgggcgagaatggcctgttt
ggcgatgaagagacgcgtatcctgacgccagccattaccgatgcccgcgcaaaaggtatg
gacgtttatgggccgtgcccgccggatactgtatttctccaggcttatgaggggcagtat
gatatggtggtggcgatgtatcatgaccaggggcatatcccgttgaaattgcttggcttt
tatgatggcgtgaatatcaccgcggggctgccgtttattcggacctctgctgatcatggc
accgcatttgatatcgcctggacgggaaaagcaaaatctgagagcatggccgtatcgatc
aaactggcaatgcaactggcataa

DBGET integrated database retrieval system