KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_29631Help
Entry
DT104_29631       CDS       T02874                                 

Gene name
yqcB
Definition
(GenBank) putative RNA pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Brite
KEGG Orthology (KO) [BR:send00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:send03016]
    DT104_29631 (yqcB)
Enzymes [BR:send01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     DT104_29631 (yqcB)
Transfer RNA biogenesis [BR:send03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    DT104_29631 (yqcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CCW75663
UniProt: A0A0U1GGA2
Position
complement(3149523..3150305)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDPWLVAVNKPAGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGWLMDDAVLDYPLVEERDKIADKFAREDK
APQPAVTQYRGLATVEMAVPTGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFACRRLMLHASRLELTHPFTGQPLIIQAGLDETWMQALTQFGWRGLL
PDNERVEFTAASRQDETHLT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatcctctatcaagacccgtggctggttgccgtgaataaacccgcaggctgg
cttgttcaccggagctggctggatcgcgacgaaaaagtcgtggtcatgcaaacggtgcgc
gaccaaatcggccagcatgtttttaccgcccaccgtctcgacaggcccacgtcgggcgta
ctgttaatggggctgtccagcgaagcgggacgccgtctggcgcagcagttcgagcagcac
cacatccgtaaacgctaccatgccattgtgcgcggctggctgatggatgacgcggtactg
gattatccgctggtggaagagcgcgataaaattgccgataaattcgcccgcgaagataaa
gcgccccagccggccgtaacgcagtatcgcgggctggcgacggtcgaaatggcggtgccg
accgggcgttatcccaccacgcgttatggcctggttgagctggaaccaaaaacgggacgc
aagcaccagcttcgtcgtcatctggcgcatctgcgtcatcctatcatcggcgacagtaaa
catggcgatttgcgacaaaaccgcagcgccgcagagcattttgcctgtcgtcgcctgatg
cttcatgccagtcgtcttgaactgacgcaccccttcaccggacagccgttgataattcag
gccgggttggatgaaacctggatgcaggcgctgacgcagtttggctggcgtggacttctc
cctgacaatgaaagggttgagtttacggcggcgtcccggcaggatgagactcatctgaca
taa

DBGET integrated database retrieval system