KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_34211Help
Entry
DT104_34211       CDS       T02874                                 

Definition
(GenBank) 50s ribosomal protein l22
  KO
K02890  large subunit ribosomal protein L22
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Pathway
send03010  Ribosome
Brite
KEGG Orthology (KO) [BR:send00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DT104_34211
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:send03011]
    DT104_34211
Ribosome [BR:send03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DT104_34211
  Bacteria
    DT104_34211
  Archaea
    DT104_34211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CCW76119
Position
complement(3626486..3626734)
Genome map
AA seq 82 aa AA seqDB search
MSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPR
AKGRADRILKRTSHITVVVSDR
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcaggctctggatattctgacctacaccaacaagaaagcggctgtactggtcaag
aaagttctggaatctgccattgctaacgctgaacacaacgatggcgctgacattgacgat
ctgaaagttacgaaaattttcgtagacgaaggcccgagcatgaagcgcattatgccgcgt
gcaaaaggtcgtgcagatcgcatcctgaagcgcaccagccacatcactgtggttgtgtcc
gatcgctga

DBGET integrated database retrieval system