KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_36691Help
Entry
DT104_36691       CDS       T02874                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Pathway
send00051  Fructose and mannose metabolism
send01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:send00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DT104_36691 (mtlD)
Enzymes [BR:send01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     DT104_36691 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: CCW76367
UniProt: A0A0U1JKM4
Position
3911279..3912427
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENEQVDTV
SGVNAVSSIGDDVVDLIAHVDLITTAVGPVVLERIAPAIAKGLVKRKAQGVDAPLNIIAC
ENMVRGTTQLKGHVMNALADGDKAWVEQHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DESIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHVNLVKGIAAAMHFRSDEDPQAQELAALITEKGPQAALAQ
ISGLDANSDVVAEAVNAYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggcaaattgctg
gctgacgcggggatacaactgacgtttgcggatgtaaaccaggtcgtactcgatgccctg
aatgcccgtcatagctatcaggttcatgttgtgggtgaaaatgagcaggtggataccgtt
tccggcgtcaacgctgtcagcagcatcggcgatgatgttgtcgacctgattgcccacgtt
gatttaatcaccactgccgtgggcccggtggtgcttgagcgtatcgctccggctatcgct
aaagggctggtaaaacgtaaggcgcagggcgtggatgccccgctgaatatcatcgcctgt
gaaaatatggtgcgcggcaccacgcagctgaaaggccacgtaatgaacgcgctggcggat
ggcgataaagcctgggttgaacagcacgtcggttttgtcgattccgccgttgaccgtatt
gtgccgccatctgcttctgcgaccaacgatccgctggaagtgacggtagaaacgttcagc
gagtggattgtcgataaaacccagtttaaaggcgcgttgccaaacattccggggatggag
ttaacggataacctgatggcatttgtcgaacgtaaactcttcacgctgaacacaggtcat
gctataaccgcgtacctcggcaaattagccggtcatcaaaccattcgcgacgctattctc
gatgagagtattcgcgcggtggtgaaaggcgcgatggaagaaagcggcgcggtgctgatc
aaacgctacggttttgatgccgacaaacatgcggcatacattcagaaaatcctcggtcgt
tttgaaaacccgtatctgaaagatgacgtcgaacgcgtaggtcgtcagccgctacgcaaa
ctcagcgcgggcgaccgtctgatcaaaccgctgcttggcaccctggaatatggtctgccg
catgtaaatctggtcaaagggatcgcggcggcgatgcatttccgtagtgatgaagatccg
caggcgcaggagttggcggctctgattaccgaaaaaggcccgcaggccgcgctggcgcaa
atttccgggctggatgccaatagcgatgtggtggcggaggcggttaacgcatataacgcg
accaaatga

DBGET integrated database retrieval system