KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_40331Help
Entry
DT104_40331       CDS       T02874                                 

Gene name
yihX
Definition
(GenBank) putative haloacid dehalogenase-like hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Pathway
send00010  Glycolysis / Gluconeogenesis
send01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:send00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DT104_40331 (yihX)
Enzymes [BR:send01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     DT104_40331 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD AdoMet_dc PNK3P
Motif
Other DBs
NCBI-ProteinID: CCW76731
UniProt: A0A0U1FUL7
Position
4312948..4313547
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGVWSDLSRVPLASLKQKFTMGETFHQHERGEITDEAFAEA
FCHEMALSLSYEQFAHGWQAVFVGLRPEVIAIMHKLREQGHRVVVLSNTNRLHTHFWPEE
YPEVRAAADHIYLSQDLGMRKPEARIYQHVLQKEGFSAADAVFFDDNADNIEGANQLGIT
SILVKDKATIPDYFAKLLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctacatctttgatttaggtaatgtgattgtcgacatcgactttaaccgcgtatta
ggtgtgtggagcgatctgagtcgagtaccgctggcttcgctgaagcaaaaatttacgatg
ggcgagacttttcaccaacatgaacgcggtgagataacggacgaagcgtttgctgaagct
ttctgtcatgaaatggcgttatcgctcagttatgaacaatttgcgcacggctggcaggcg
gtatttgtcggattacggcccgaggtgattgctatcatgcataaactgcgcgagcagggg
catcgcgtggtggtgctatccaatactaaccgactgcatacccacttctggccggaggaa
tacccggaggtgcgcgctgccgccgaccatatctatttatcgcaggatttgggaatgcgt
aagccggaagcgcgtatttatcagcacgtcctgcagaaagaaggtttttccgctgccgat
gcggtctttttcgacgacaatgccgataatatagaaggggccaaccagttggggatcacc
agtattctggtgaaggataaagccaccatccctgactatttcgcgaagctgttatgctaa

DBGET integrated database retrieval system