KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_42861Help
Entry
DT104_42861       CDS       T02874                                 

Gene name
basS
Definition
(GenBank) two-component sensor kinase
  KO
K07643  two-component system, OmpR family, sensor histidine kinase BasS [EC:2.7.13.3]
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Pathway
send01503  Cationic antimicrobial peptide (CAMP) resistance
send02020  Two-component system
Brite
KEGG Orthology (KO) [BR:send00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DT104_42861 (basS)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    DT104_42861 (basS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:send01001]
    DT104_42861 (basS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:send02022]
    DT104_42861 (basS)
Enzymes [BR:send01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DT104_42861 (basS)
Protein kinases [BR:send01001]
 Histidine kinases
  OmpR family
   DT104_42861 (basS)
Two-component system [BR:send02022]
 OmpR family
  BasS-BasR (antimicrobial peptide resistance)
   DT104_42861 (basS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HEPN_DZIP3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: CCW76984
Position
complement(4609546..4610616)
Genome map
AA seq 356 aa AA seqDB search
MRFQRRAMTLRQRLMLTIGLILLVFQLISTFWLWHESTEQIQLFEQALRDNRNNDRHIMH
EIREAVASLIVPGVFMVSLTLLICYQAVRRITRPLAELQKELEARTADNLAPIAIHSSTL
EIESVVSAINQLVTRLTTTLDNERLFTADVAHELRTPLSGVRLHLELLSKTHNVDVAPLI
ARLDQMMDSVSQLLQLARVGQSFSSGNYQEVKLLEDVILPSYDELNTMLETRQQTLLLPE
SAADVVVRGDATLLRMLLRNLVENAHRYSPEGTHITIHISADPDAIMAVEDEGPGIDESK
CGKLSEAFVRMDSRYGGIGLGLSIVSRITQLHQGQFFLQNRTERTGTRAWVLLKKA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttcagcgaagagcgatgacccttcgccagcgtttaatgctgacaattggtctt
attctgctggtgttccagttaatcagtaccttctggttatggcatgaaagcactgagcaa
atccaattgttcgagcaggcgctgcgggataatcgcaacaacgatcgccatatcatgcac
gaaattcgcgaggcggtcgccagcctgatcgtccccggcgtatttatggttagcctgacg
ctgctaatttgttaccaggcggtacggcgtattacccgtccgctcgccgaactgcaaaaa
gagctggaagcgcggacggcggataatctggcgccgatcgccattcacagctccacgctt
gagattgagtccgtcgtctcggcgatcaatcaactggttacgcgtttgaccaccacgctc
gacaatgaacgcctttttaccgccgatgtggcccatgagctacgcacgccgctgtcgggg
gtgcgtttgcacctggaattattgtcaaaaacccacaatgttgatgtcgcgccgcttatc
gcccgtcttgaccagatgatggatagcgtctcccagcttctgcaactggcgcgcgtgggc
cagtcattctcttccgggaattatcaggaagtaaaactgctggaagatgtgatcctcccc
tcctacgatgagctgaacaccatgctggaaacgcgccagcaaactctgttgctgccggaa
agcgcggcggacgtggtggtgcgcggtgatgcgacgttactgcgtatgctgttgcgaaat
ctggtggaaaacgcgcatcgctatagccctgaaggaacccatatcactatccacattagc
gccgaccccgacgctattatggcggtcgaagacgaggggccgggtattgatgaaagcaaa
tgcgggaagctaagcgaagcgttcgtgcggatggacagccgttatggcggaattggcctg
gggctgagtatcgtcagccgcatcacccaactacatcagggacagtttttcctgcaaaac
cgtacggaaagaacaggcacccgtgcctgggtgctgttgaaaaaggcataa

DBGET integrated database retrieval system