KEGG   Salmonella enterica subsp. enterica serovar Thompson: IA1_06400Help
Entry
IA1_06400         CDS       T02868                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
sene  Salmonella enterica subsp. enterica serovar Thompson
Pathway
sene00450  Selenocompound metabolism
sene01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sene00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    IA1_06400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sene03016]
    IA1_06400
Enzymes [BR:sene01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     IA1_06400
Transfer RNA biogenesis [BR:sene03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    IA1_06400
 Prokaryotic type
    IA1_06400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AGX10349
Position
1341655..1342698
Genome map
AA seq 347 aa AA seqDB search
MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSIISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIARE
VTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTERVKKNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLSEM
CQGAGVQALLCYQDIPKLPGVEEYIALGAVPGGTERNFASYGHLMGDMSREVRSLLCDPQ
TSGGLLLAVTPDAEDDVKATAAEFGIDLTAIGELVEARGGRAMVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaagccattcgtttaacgcaatacagccacggcgctggttgcggttgtaaa
atttcccctaaagtgctggagactatcctgcatagcgagcaggcgaagttcgtcgacccg
aatctgctggtgggtaatgaaacccgcgatgatgcggcggtttacgatctgggtaatggc
accagtattatcagcaccaccgacttctttatgccgatagtcgataacccgtttgatttt
ggccgcattgcggcaacaaacgccatcagcgatatttttgcgatgggcggcaaaccgatc
atggcgatcgcgatccttggctggccgattaataccctgtcgcccgatattgcgcgtgaa
gtgaccgagggggggcgctttgcctgccgtcaggccggtatcgcgctggcgggcggacac
tctattgacgccccggagccgatctttggtctcgcggtcacaggcgtagtgccgaccgaa
cgggtgaagaaaaacagtaccgcgcaggcgggatgcaaactctttctgaccaaaccgttg
gggattggcgtgttgaccaccgccgagaaaaaatcgctgcttaaacctgaacatcagggg
ctggcgacggaagtcatgtgtcggatgaacgttgctggcgcggcgtttgccaatatcgac
ggcgtaaaagctatgactgacgttaccggttttggcctgctggggcacctgagcgagatg
tgccagggcgcaggcgtgcaggcgctgctttgctatcaggacatccctaaactgccgggc
gtggaagagtatattgctctgggcgccgtaccgggcggcacagagcgcaacttcgccagc
tatggtcatctgatgggcgacatgtcgcgtgaagttcgtagcctgctgtgcgatccgcaa
acgtcaggcggtctgttgttggcggtaacgccggacgccgaagacgatgttaaagccacc
gcggcggaatttggtatcgatctgaccgcgattggcgaactggtcgaggcccgcggcggt
cgcgctatggttgagattcgttaa

DBGET integrated database retrieval system