KEGG   Salmonella enterica subsp. enterica serovar Thompson: IA1_14540Help
Entry
IA1_14540         CDS       T02868                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sene  Salmonella enterica subsp. enterica serovar Thompson
Pathway
sene00071  Fatty acid degradation
sene00280  Valine, leucine and isoleucine degradation
sene00310  Lysine degradation
sene00362  Benzoate degradation
sene00380  Tryptophan metabolism
sene00620  Pyruvate metabolism
sene00630  Glyoxylate and dicarboxylate metabolism
sene00640  Propanoate metabolism
sene00650  Butanoate metabolism
sene00900  Terpenoid backbone biosynthesis
sene01100  Metabolic pathways
sene01110  Biosynthesis of secondary metabolites
sene01120  Microbial metabolism in diverse environments
sene01130  Biosynthesis of antibiotics
sene01200  Carbon metabolism
sene01212  Fatty acid metabolism
sene02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sene00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IA1_14540
   00630 Glyoxylate and dicarboxylate metabolism
    IA1_14540
   00640 Propanoate metabolism
    IA1_14540
   00650 Butanoate metabolism
    IA1_14540
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IA1_14540
   00072 Synthesis and degradation of ketone bodies
    IA1_14540
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IA1_14540
   00310 Lysine degradation
    IA1_14540
   00380 Tryptophan metabolism
    IA1_14540
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IA1_14540
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IA1_14540
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IA1_14540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sene04147]
    IA1_14540
Enzymes [BR:sene01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IA1_14540
Exosome [BR:sene04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IA1_14540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGX11635
Position
complement(3042708..3043916)
Genome map
AA seq 402 aa AA seqDB search
MAVSFCAEVVMKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDE
VILGQVLTAGAGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIV
IAGGQENMSRAPHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGI
SRELQDAYALSSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLAL
LHPAFDSLGSVTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGI
APVYATRRCLERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPI
GASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcattttgcgctgaggtggtaatgaaagaggttgtgatagtgggggcttta
cggacacccatcggctgttttcagggaacgctggcccgtcattccgccgtcgagctgggg
agcatggtcgtaaaagcgttaattgagcgcaccggcgtggacgctaacgctatcgatgag
gtcatcctcggtcaggtgctgacggctggcgccgggcagaatccggcgcgccagtcagcc
atcaaaggagggctgccgactaccgtttccgctattaccattaatgacgtttgtggttcc
ggtttaaaagcgttgcacctggcgacgcaggctattcagtgcggcgaagcggacattgtt
attgcgggcgggcaggagaatatgagccgtgcgccgcatgtcctcaatgacagccgtacc
ggcgcgttgcctgatgccgacaatctggtggatagtctggtacatgatggcttatgggat
gccttcaacgattatcacattggcgtgacggcagaaaacctggcgcgggaatatggcatc
agccgcgagttacaggatgcttatgcgctcagttcgcagcaaaaagccagggccgcgatt
gataccggacgttttaaagatgagattgtccccatcgtcacgcaacgtaatgggcagacc
gcaattgtcgatacggatgaacaaccgcgggccgacgccagtgcggaggggttagccctg
ctgcatccggcgtttgatagtttaggttcggtgacggcgggtaatgcctcctcaatcaac
gatggcgccgccgcggtgatgatgatgagcgaggcgaaagcccaggcgctggggctgccg
gtgctggcgcgcatccgcgcgtttgccagcgtcggcgtcgatcctgcgctaatggggatt
gcgccggtatatgctacccggcgctgtctggagcgtgccggctggcaactgacggaggtc
gaccttatcgaagccaacgaagcgtttgccgcccaggcgttgtcggtaggaaaaatgctg
gaatgggatgagcgacgggtaaacgttaatggcggcgcgattgcgctggggcatcctatt
ggcgcttccggctgtcgaattctggtttcactggtgcacgaaatggttaaacgcgacgcg
cgtaaaggcctggcgacgctgtgtatcggtggtggccagggcgttgctttaaccattgaa
cgcgattga

DBGET integrated database retrieval system