KEGG   Salmonella enterica subsp. enterica serovar Thompson: IA1_17110Help
Entry
IA1_17110         CDS       T02868                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sene  Salmonella enterica subsp. enterica serovar Thompson
Pathway
sene00561  Glycerolipid metabolism
sene00640  Propanoate metabolism
sene01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sene00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    IA1_17110 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    IA1_17110 (gldA)
Enzymes [BR:sene01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     IA1_17110 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC
Motif
Other DBs
NCBI-ProteinID: AGX12056
Position
complement(3552174..3553283)
Genome map
AA seq 369 aa AA seqDB search
MVTTAIFPSRYVQGKGALTTHLPQELAALGHKALILQDPVVHNTYRDTVATALHGVIEFD
IEVFSSECSDEEIARISARAQEIGADVIVGMGGGKTLDTAKATGASLRLPIAVVPTLAST
DAPCSSLVVIYTPEGKFKRYLMIPRNPTLVLVDSSIIAAAPVRFLVSGIGDALATWFEAE
DCRIKGAGNMTTRPGPMTAFELARFCYTTLMRYGRLAKLACEQHQVTPALEHVIEANTLL
SGLGFESGGLAAAHAIHNGLTVLPATHKYWHGEKVAFGTLAMLMLTDRAPELIEEVYQFC
EDIGLPTTLADIGLAGVSDDELLAVARASCQTGETMHNEPFTITPEAVQAALRAADAVGQ
ARKKIDLAG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggttactaccgcgatctttccgtcacgatatgttcagggtaaaggagcgttgacaacg
catctcccgcaggaattggccgcactcggtcataaggcgctgattttgcaggatcctgtt
gttcacaacacctaccgggatacagttgcaacagcactgcacggggtgattgaatttgat
atcgaagtgttcagtagcgagtgcagtgatgaggaaattgctcgcatctccgcacgcgcg
caggaaattggcgccgatgtgattgttggtatggggggcgggaaaaccctggatacggca
aaagcaaccggcgccagcctgcggctgcctattgccgtggttcctactctggcctcaacg
gatgcgccgtgcagttcactggttgttatctatacgccagaagggaaattcaaacgctac
ctgatgattccacgtaacccgacgcttgtgctggtggacagcagtattattgctgccgcg
ccggtacgctttttggtttccgggataggcgatgcgctggcaacctggtttgaagcggaa
gattgccgcatcaaaggggcaggcaatatgaccaccaggccaggaccgatgaccgcattt
gagctggcgcgcttttgctacaccaccttaatgcgctatgggcgcctggcgaagcttgcc
tgtgaacaacatcaggttactccggcgctcgaacatgttatcgaagcgaatacactatta
tccgggctcggttttgaaagcggtgggctggcggcggcgcacgccattcataacggtctg
acggtactgcccgccacgcacaaatactggcatggggaaaaggttgcgtttggcacgctg
gcaatgcttatgctcaccgatagagcgcctgagcttatcgaggaggtttatcaattttgt
gaagatataggcttgcccaccacgctggcggatattggtctggctggcgttagcgatgat
gaactgctggccgttgccagggcgtcttgtcaaactggggaaacgatgcacaacgagccg
tttaccattacgccggaggctgtgcaggcggcattgcgggccgccgatgctgttgggcag
gcgcggaaaaagatcgatcttgcaggttaa

DBGET integrated database retrieval system