KEGG   Salmonella enterica subsp. enterica serovar Thompson: IA1_19670Help
Entry
IA1_19670         CDS       T02868                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sene  Salmonella enterica subsp. enterica serovar Thompson
Pathway
sene00010  Glycolysis / Gluconeogenesis
sene00071  Fatty acid degradation
sene00350  Tyrosine metabolism
sene00625  Chloroalkane and chloroalkene degradation
sene00626  Naphthalene degradation
sene01100  Metabolic pathways
sene01110  Biosynthesis of secondary metabolites
sene01120  Microbial metabolism in diverse environments
sene01130  Biosynthesis of antibiotics
sene01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sene00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IA1_19670
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IA1_19670
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    IA1_19670
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    IA1_19670
   00626 Naphthalene degradation
    IA1_19670
Enzymes [BR:sene01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     IA1_19670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Glycolytic
Motif
Other DBs
NCBI-ProteinID: AGX12455
Position
complement(4107332..4108480)
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMS
YHLFDEVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVML
EIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINVWLPKAVDDGHNLEARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARFA
RIAQAMGVETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADP
CAPCNPRTASRDEVRGLYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatgttggcactgccaaaaattagcctgcatggcgctggagcgattgccgat
atggtgaacctcgtggcgaataagcaatggggcaaagcgctgatcgttaccgatggtcaa
ctggtaaagctgggcctgctggatagcctgtttagcgcactggatgaacatcaaatgtct
taccacctgtttgatgaggtgttcccaaatccgacagaagagctggtgcagaaaggtttt
gcggcgtatcagagcgcagaatgtgactacattatcgccttcggcggcggcagcccgatc
gataccgcaaaagcggtgaaaatcctcaccgccaacccaggtccatctaccgcctactcc
ggcgtcggcaaagtgaaaaacgccggcgtaccgctggtagcgattaacactacggcaggt
accgcggcagagatgaccagcaacgcggtgattatcgactctgcccgtaaggtcaaagag
gtgatcatcgacccgaacatcatcccggatattgccgtggatgacgccagcgttatgctg
gaaatccccgcttctgtgaccgccgcaaccggcatggatgccctgacccatgcggtggaa
gcctatgtctccgttggcgcgcatccgctcaccgacgctaacgcgctggaagcgattcgc
ttaatcaatgtgtggctaccgaaagcggttgacgatggccataacctcgaagcccgtgag
caaatggcattcggccagtacctggcgggtatggcgttcaacagcgccggtttggggctg
gttcacgcgctggcgcaccagccgggcgcaactcacaacctgccgcacggcgtctgcaac
gctatcctgctgccaattgtcgagaactttaaccgtccgaacgccgtcgcgcgttttgcc
cgcatcgcacaggcgatgggcgtggagacgcgcggtatgtctgacgaagccgcaagtcag
gaagcgattaacgctatccgtacgctgagcaaacgcgtcggcattccagaaggtttcagc
aagctgggcgtcacaaaagaagatatcgaaggctggctggataaagccctcgccgacccg
tgcgcgccgtgtaacccgcgcaccgccagccgcgatgaagttcgcgggctgtacctggag
gcgttatga

DBGET integrated database retrieval system