KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_08785Help
Entry
CFSAN002069_08785 CDS       T02735                                 

Gene name
apaG
Definition
(GenBank) cobalt transporter
  KO
K06195  ApaG protein
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Brite
KEGG Orthology (KO) [BR:senh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CFSAN002069_08785 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AGQ77615
Position
complement(575963..576340)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDENGDAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgcccagagtgtgtattcaggtgcaaagcgtctacattgaggcgcaatcc
tcacctgacgatgaacgttacgtttttgcctataccgtaaccatccgcaatctgggccgg
gcgccagtgcagctattgggccgctactggctgattaccaatggtcatggccgtgaaacc
gaagtccagggcgaaggtgtggttggcgtccagccgcgcattgcgcctggcgaagagtac
cagtacaccagcggcgcggtaattgaaacgccgctgggcaccatgcagggtcattacgaa
atgatcgatgaaaatggcgacgcctttaccatcgacatccccgtgtttcgactcgccgtc
cctacactcattcactaa

DBGET integrated database retrieval system