KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_10105Help
Entry
CFSAN002069_10105 CDS       T02735                                 

Definition
(GenBank) peptidyl-prolyl cis-trans isomerase
  KO
K03773  FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC:5.2.1.8]
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Brite
KEGG Orthology (KO) [BR:senh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:senh03110]
    CFSAN002069_10105
Enzymes [BR:senh01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CFSAN002069_10105
Chaperones and folding catalysts [BR:senh03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    CFSAN002069_10105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C FKBP_N
Motif
Other DBs
NCBI-ProteinID: AGQ77828
Position
278583..279203
Genome map
AA seq 206 aa AA seqDB search
MATPTFDTIEAQASYGIGLQVGQQLSESGLEGLLPEALVAGIADALEGKHPAVPVDVVHR
ALREIHERADAVRRERFKAMAAEGVKYLEENREKDGVNSTESGLQFRVLTQGEGAIPART
DRVRVHYTGKLIDGTVFDSSVARGEPAEFPVNGVIAGWIEALTLMPVGSKWELTIPQELA
YGERGAGASIPPFSTLVFEVELLEIL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgacttttgacactattgaagcgcaagcgagctacggcattggtttgcag
gtagggcagcagctcagcgaatccggtcttgaagggctattgcctgaagcgctggttgca
ggcattgctgatgcgctggaaggtaaacacccggcggttcctgttgatgtggtgcatcgc
gcgctgcgtgaaattcatgagcgtgcggacgcggtgcgtcgtgagcgtttcaaagcgatg
gcggccgaaggcgtgaaatacctggaagaaaaccgcgaaaaagacggtgtgaacagtact
gagtctggtttacagttccgcgttctgacgcagggcgaaggcgcgattccggcgcgtacc
gaccgcgtacgcgtgcattacaccggtaagcttattgatggcaccgtatttgacagctcc
gtcgcgcgcggcgaaccggctgaattcccggtaaatggcgtgatcgccggctggattgaa
gcgctgactctgatgccggtaggttccaaatgggaactgactatcccacaggagctggcc
tatggcgagcgtggggccggggcatctattccgccattcagcaccctggtgtttgaggtg
gaactgctggaaattctctaa

DBGET integrated database retrieval system