KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_17120Help
Entry
CFSAN002069_17120 CDS       T02735                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Pathway
senh00071  Fatty acid degradation
senh00280  Valine, leucine and isoleucine degradation
senh00310  Lysine degradation
senh00362  Benzoate degradation
senh00380  Tryptophan metabolism
senh00620  Pyruvate metabolism
senh00630  Glyoxylate and dicarboxylate metabolism
senh00640  Propanoate metabolism
senh00650  Butanoate metabolism
senh00900  Terpenoid backbone biosynthesis
senh01100  Metabolic pathways
senh01110  Biosynthesis of secondary metabolites
senh01120  Microbial metabolism in diverse environments
senh01130  Biosynthesis of antibiotics
senh01200  Carbon metabolism
senh01212  Fatty acid metabolism
senh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:senh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFSAN002069_17120
   00630 Glyoxylate and dicarboxylate metabolism
    CFSAN002069_17120
   00640 Propanoate metabolism
    CFSAN002069_17120
   00650 Butanoate metabolism
    CFSAN002069_17120
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFSAN002069_17120
   00072 Synthesis and degradation of ketone bodies
    CFSAN002069_17120
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFSAN002069_17120
   00310 Lysine degradation
    CFSAN002069_17120
   00380 Tryptophan metabolism
    CFSAN002069_17120
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFSAN002069_17120
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFSAN002069_17120
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFSAN002069_17120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senh04147]
    CFSAN002069_17120
Enzymes [BR:senh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFSAN002069_17120
Exosome [BR:senh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFSAN002069_17120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGQ78905
Position
complement(3594978..3596156)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gctattaccattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccggacgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system