KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_18320Help
Entry
CFSAN002069_18320 CDS       T02735                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Pathway
senh00310  Lysine degradation
senh01100  Metabolic pathways
senh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:senh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CFSAN002069_18320
Enzymes [BR:senh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     CFSAN002069_18320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 NAD_binding_8 FAD_binding_2 Thi4 Trp_halogenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: AGQ79091
Position
3346041..3347309
Genome map
AA seq 422 aa AA seqDB search
MYDFVIIGGGIIGMSTAMQLIDLYPDARIALLEKESAPACHQTGHNSGVIHAGVYYTPGS
LKARFCLAGNQATKTFCDQNNIRYDTCGKMLVATSELEMARMRALWERTAANGLEREWLS
AAELREREPNIIGLGGIFVPSSGIVSYRDVATAMANRFQAKGGEIIYHAEVSALTEHAAG
VVIRTSQGREIETATLIGCAGLMADRLVKMLGVEPGFIICPFRGEYFRLAPRHNRIVNHL
IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDVSFTDTLEIFRSAGIRR
VLQNHLLSGLGEMKNSLCKSGYLRRVQKYCPSLTVNDLQPWPAGVRAQAVSPDGKLIDDF
LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVQALRASQSNPGRTLRAARSVDALHAAF
TR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattttgtgattatcggcggcggcattatcggcatgtcgaccgccatgcaactt
attgatctctatccggatgcgcgcatcgcgttgctggaaaaagagtccgcgccagcctgc
caccagaccgggcataacagcggcgtgatccatgccggggtgtactacacgcccggcagc
ctcaaagcgcggttttgtctggcgggcaatcaggcgaccaaaaccttttgcgatcaaaac
aacatccgctacgacacctgcggcaaaatgttggtcgccacctcggagctggaaatggcg
cggatgcgcgcgctatgggagcggacggcggccaacggcttagagcgcgagtggttaagc
gcggcggagctgcgtgaacgcgaacccaatatcattggcctgggcgggatttttgtccct
tccagcgggattgtcagctatcgcgatgtcgcgacggccatggcgaaccgctttcaggcc
aaaggcggcgagatcatctaccatgccgaggtcagcgcgctaacagaacatgccgctggc
gttgtcattcgcacctcgcaaggtcgggaaatcgaaaccgctacgcttatcggctgtgca
gggctgatggcggatcggctggtcaaaatgctgggcgtggagcccggttttattatctgc
cctttccgcggcgagtactttcgtctggccccgcggcacaaccggatcgttaaccatttg
atctacccgatccccgatccggcaatgccgtttctcggcgtccatcttacccgcatgatc
gacggcagtgtcacggtcgggccgaatgcggtgctggcgcttaaacgcgaaggctaccgt
aagcgcgacgtttccttcaccgacaccctggagattttccgctccgccggcattcgccgc
gtactgcaaaaccatctgctttccggactgggcgagatgaaaaactcgctgtgcaaaagc
ggctatttgcggcgagtacaaaagtattgccccagcctgaccgtcaacgatctccagccc
tggccggcaggcgtgcgggcgcaggcggtttcaccggacggcaaactgattgatgatttt
ctgtttgtcacgacgccgcgttccattcacacctgtaacgccccctccccggcggcgaca
tcagcgatacctatcggcgcgcatatcgtcagtaaagttcaggcgctacgcgcaagccag
agcaaccccggacgtacgctgcgtgcggcacgcagcgtggacgcactacacgccgcattt
acccgttaa

DBGET integrated database retrieval system