KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_22215Help
Entry
CFSAN002069_22215 CDS       T02735                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Pathway
senh02020  Two-component system
senh02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:senh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFSAN002069_22215
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    CFSAN002069_22215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:senh01001]
    CFSAN002069_22215
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:senh02022]
    CFSAN002069_22215
   02035 Bacterial motility proteins [BR:senh02035]
    CFSAN002069_22215
Enzymes [BR:senh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CFSAN002069_22215
Protein kinases [BR:senh01001]
 Histidine kinases
  CheA family [OT]
   CFSAN002069_22215
Two-component system [BR:senh02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   CFSAN002069_22215
Bacterial motility proteins [BR:senh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CFSAN002069_22215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW CheY-binding Hpt H-kinase_dim HATPase_c
Motif
Other DBs
NCBI-ProteinID: AGQ79723
Structure
PDB: 

Position
complement(2498217..2500226)
Genome map
AA seq 669 aa AA seqDB search
MDISDFYQTFFDEADELLADMEQHLLDLVPESPDAEQLNAIFRAAHSIKGGAGTFGFTIL
QETTHLMENLLDEARRGEMQLNTDIINLFLETKDIMQEQLDAYKNSEEPDAASFEYICNA
LRQLALEAKGETTPAVVETAALSAAIQEESVAETESPRDESKLRIVLSRLKASEVDLLEE
ELSNLATLTDVVKGADSLSATLDGSVAEDDIVAVLCFVIEADQIAFEKVVAAPVEKAQEK
TEVAPVAPPAVVAPAAKSAAHEHHAGREKPARERESTSIRVAVEKVDQLINLVGELVITQ
SMLAQRSNELDPVNHGDLITSMGQLQRNARDLQESVMSIRMMPMEYVFSRFPRLVRDLAG
KLGKQVELTLVGSSTELDKSLIERIIDPLTHLVRNSLDHGIEMPEKRLEAGKNAVGNLIL
SAEHQGGNICIEVTDDGAGLNRERILAKAMSQGMAVNENMTDDEVGMLIFAPGFSTAEQV
TDVSGRGVGMDVVKRNIQEMGGHVEIQSKQGSGTTIRILLPLTLAILDGMSVRVAGEVFI
LPLNAVMESLQPREEDLHPLAGGERVLEVRGEYLPLVELWKVFDVDGAKTEATQGIVVIL
QSAGRRYALLVDQLIGQHQVVVKNLESNYRKVPGISAATILGDGSVALIVDVSALQGLNR
EQRMAITAA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggatattagcgatttttatcagacattttttgatgaagctgacgagctgttggctgat
atggagcagcatctgctggatttggtgccggagtccccggacgctgaacaactgaacgcc
atttttcgcgcggcgcactccattaaaggcggcgcgggcacattcggcttcactattctg
caggaaaccacacatttaatggaaaacctgctggatgaagcccgacgcggtgaaatgcag
ctcaataccgacattatcaacctgtttttggaaacgaaagatattatgcaggaacagctc
gacgcctataaaaactccgaagagccggatgccgcaagcttcgaatatatctgcaatgcg
ctacgccagttggcgctggaggcgaaaggcgaaaccacgccggcggtcgtagaaaccgcg
gcactaagcgcggcgatccaggaagagagcgtagccgaaaccgaatcgcctcgtgacgag
agtaaactgcgcattgtactttcacggttgaaagccagtgaggtcgatctgcttgaagaa
gagttgagtaatctggctactctgacggatgtcgttaagggggcggattcactgtcggca
acgctggatggcagcgtcgcggaagatgacattgtcgcggtgctctgttttgtcatcgag
gccgatcagatcgcttttgaaaaagtggtcgccgcgcccgtggaaaaagcgcaagagaaa
accgaggtagcgccggtagcgcctccggcagtcgttgcgccagccgccaaaagcgcggcc
catgaacatcatgcggggcgtgaaaaacctgcgcgtgaacgcgagtccaccagcattcgc
gtggcggtagagaaagtggatcagctcataaacctggtcggcgagttagtgattacccag
tcaatgttggcccagcgttctaacgagctggacccggtaaaccacggcgatctcattacc
agtatggggcagttacaacgtaacgcccgcgacttacaagagtcggtgatgtcgattcgt
atgatgcctatggagtacgtcttcagccgtttcccgcgtctggtacgcgatttagcgggc
aaactgggcaagcaggtagagctgacgctggtggggagctccactgaacttgataaaagc
ctgatcgaacgcattatcgacccgctgacgcacctggtgcgcaacagtctcgaccacggg
attgaaatgccggaaaaacgccttgaggcggggaaaaatgctgtcggcaacctgattctt
tccgcagaacatcagggcgggaatatttgtattgaagtgaccgatgacggcgcggggctt
aaccgtgagcgtatcctggcgaaggccatgtcgcaggggatggcggtgaatgaaaacatg
accgacgatgaagtaggcatgttgatcttcgcgccgggattctcaactgcggaacaggtc
acggatgtctccggtcgcggcgttggcatggatgtggtgaaacgtaacattcaggagatg
ggcggtcacgttgagatccagtcaaaacaaggctccggcaccacgattcgtattctgctg
ccgctgacgctggccatcctcgatgggatgtcggttcgcgtggcgggggaagtttttatc
ctgccgttaaatgcggtgatggagtcgctgcaaccgcgtgaagaggatcttcatccgctg
gcgggcggcgaacgggttctggaagttcgcggcgagtatttgccgctggtcgaattgtgg
aaagtgtttgacgtggacggggcgaaaaccgaagccacgcagggcattgttgtgatcctg
caaagcgcgggacgccgttacgcgctgctggtcgatcagctcatcggtcagcaccaggtg
gtggtcaaaaatctggaaagcaattatcgcaaggtaccggggatttccgccgcgacgatc
ctgggcgacggcagcgtcgcgctgattgttgatgtttccgcattgcagggtttaaaccgc
gaacaacgtatggcgatcacagccgcctga

DBGET integrated database retrieval system