KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 138736: CY43_07765Help
Entry
CY43_07765        CDS       T03493                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
seni  Salmonella enterica subsp. enterica serovar Typhimurium 138736
Pathway
seni00250  Alanine, aspartate and glutamate metabolism
seni00650  Butanoate metabolism
seni00760  Nicotinate and nicotinamide metabolism
seni01100  Metabolic pathways
seni01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:seni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CY43_07765
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CY43_07765
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CY43_07765
Enzymes [BR:seni01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     CY43_07765
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     CY43_07765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PSD4
Motif
Other DBs
NCBI-ProteinID: AHX77258
UniProt: A0A0D6G4U7
Structure
PDB: 

Position
1582586..1583974
Genome map
AA seq 462 aa AA seqDB search
MTMMTATQALSVNPATGQTLAAMPWANAQEIEHALSLAASGFKKWKMTSVAQRAQTLRDI
GQALRAHAEEMAQCITREMGKPIKQARAEVTKSAALCDWYAEHGPAMLNPEPTLVENQQA
VIEYRPLGVILAIMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQMIARILAEAG
TPAGVYGWVNANNEGVSQMINDPRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTDRFVAAAAALKMGDP
LVEENDLGPMARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVTPDMT
AFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEMAARLECGGVFIN
GYSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKNRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgatgactgcaacacaggcgttatccgtgaatcctgcgaccggccagacgctg
gcggcaatgccctgggctaacgcgcaagagattgaacatgcgctgagtctggcggcgagc
ggtttcaaaaagtggaaaatgacatcggtagcgcaacgggcgcaaacattacgcgatatt
ggtcaggcgcttcgcgctcatgcagaagagatggcgcaatgtattacgcgtgaaatgggt
aaacccataaagcaggcgcgtgcggaagtgacgaaatccgccgcgttatgcgactggtat
gcggaacatggcccggcaatgctgaatcctgagcctacgttggtagaaaatcagcaggcg
gtgattgaataccgtccgctgggcgtcattctggcgataatgccgtggaattttccttta
tggcaggtgttacgcggggcagtgccgatactgctggcggggaatagctacttgttaaaa
catgcgcccaatgtcacgggttgcgcgcagatgatagcccgaatcttggcggaagccggt
actcccgctggcgtctatggatgggtgaacgctaataatgagggcgtgagtcagatgatt
aacgatccgcgaatcgcggcggtgacggtgaccggtagcgtgcgcgccggcgcggcgatt
ggcgctcaggctggggcggcgctgaaaaagtgcgtactggaactgggtggctcggatccg
tttattgtactcaatgatgccgatctcgagttggcggtaaaagctgcggttgccggacgc
tatcaaaacaccggacaagtctgcgccgccgccaaacgttttattgtcgaagagggcatt
gcgcaggcgtttaccgatcgttttgtggcggctgccgcagcattaaagatgggtgatcct
ctggttgaagagaatgacctggggccgatggcgcgctttgatttgcgtgatgaactccat
caacaggtgcaggcttccgtcgccgaaggcgcacggctactgttgggcggggagaaaatc
gccggggagggcaactattatgccgcgaccgttctggcggatgttacacctgacatgacg
gcatttcgtcaggaactttttgggcctgttgccgccattaccgtcgcaaaagatgcggcg
cacgccctcgcgctggcgaatgacagtgagtttggcctgtcggcgacgatctttaccgcc
gacgatacgctggccgcggagatggcggcgcgtcttgagtgcggtggggtattcattaat
ggttacagcgccagcgatgcgcgtgtggcattcggcggggtgaagaaaagcggcttcggt
cgcgagctttcgcactttggtttacacgaattttgtaatgtgcagaccgtctggaagaac
cgcgtctaa

DBGET integrated database retrieval system