KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 138736: CY43_12595Help
Entry
CY43_12595        CDS       T03493                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
seni  Salmonella enterica subsp. enterica serovar Typhimurium 138736
Pathway
seni02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:seni00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CY43_12595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:seni02000]
    CY43_12595
Transporters [BR:seni02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    CY43_12595
   Histidine transporter
    CY43_12595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 MFS_Mycoplasma
Motif
Other DBs
NCBI-ProteinID: AHX78157
UniProt: A0A3Y9F0E5
Position
complement(2531135..2531821)
Genome map
AA seq 228 aa AA seqDB search
MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVTGLIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacgggttttcaggcgtaattttacagggcgcgatcgtcacgctggaactggcg
ctcagttccgtggtgctggccgtgcttatcggtctcgtcggcgcgggggcgaagctttcg
caaaaccgggtaacggggcttatttttgaagggtacaccaccctgattcgcggggtgccg
gatctggtcttaatgctgctgatattttacggattgcaaatcgcgcttaacgtggtgacc
gattcgctgggtatcgaccagatagatattgatccgatggtggccggtattatcaccctt
ggtttcatctacggcgcctattttaccgaaacctttcgcggcgcgtttatggcggtgccg
aaaggccatatcgaggcggcgacggcctttggttttacccacgggcaaaccttccggcgg
attatgttcccggcgatgatgcgttacgccctgccggggatcggcaataactggcaggtg
atactcaaagcgacggcgctggtgtcgctgctgggcctggaagatgtcgtcaaagccacg
cagcttgccggtaaaagtacctgggagcctttctattttgccgtggtctgtggacttatc
tacctggtatttaccaccgtttccaatggtgtgctgctcttacttgagcgtcgctattcc
gtgggcgtgaagagggccgatttgtga

DBGET integrated database retrieval system