KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 138736: CY43_15465Help
Entry
CY43_15465        CDS       T03493                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
seni  Salmonella enterica subsp. enterica serovar Typhimurium 138736
Brite
KEGG Orthology (KO) [BR:seni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:seni03016]
    CY43_15465
Enzymes [BR:seni01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CY43_15465
Transfer RNA biogenesis [BR:seni03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CY43_15465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AHX78684
UniProt: A0A0D6IHN9
Position
complement(3149517..3150299)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDPWLVAVNKPAGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGWLMDDAVLDYPLVEERDKIADKFAREDK
APQPAVTQYRGLATVEMAVPTGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFACRRLMLHASRLELTHPFTGQPLIIQAGLDETWMQALTQFGWRGLL
PDNERVEFTAASRQDETHLT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatcctctatcaagacccgtggctggttgccgtgaataaacccgcaggctgg
cttgttcaccggagctggctggatcgcgacgaaaaagtcgtggtcatgcaaacggtgcgc
gaccaaatcggccagcatgtttttaccgcccaccgtctcgacaggcccacgtcgggcgta
ctgttaatggggctgtccagcgaagcgggacgccgtctggcgcagcagttcgagcagcac
cacatccgtaaacgctaccatgccattgtgcgcggctggctgatggatgacgcggtactg
gattatccgctggtggaagagcgcgataaaattgccgataaattcgcccgcgaagataaa
gcgccccagccggccgtaacgcagtatcgcgggctggcgacggtcgaaatggcggtgccg
accgggcgttatcccaccacgcgttatggcctggttgagctggaaccaaaaacgggacgc
aagcaccagcttcgtcgtcatctggcgcatctgcgtcatcctatcatcggcgacagtaaa
catggcgatttgcgacaaaaccgcagcgccgcagagcattttgcctgtcgtcgcctgatg
cttcatgccagtcgtcttgaactgacgcaccccttcaccggacagccgttgataattcag
gccgggttggatgaaacctggatgcaggcgctgacgcagtttggctggcgtggacttctc
cctgacaatgaaagggttgagtttacggcggcgtcccggcaggatgagactcatctgaca
taa

DBGET integrated database retrieval system