KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_13155Help
Entry
CFSAN001992_13155 CDS       T02479                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
senj00670  One carbon pool by folate
senj01100  Metabolic pathways
senj01120  Microbial metabolism in diverse environments
senj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:senj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CFSAN001992_13155 (metF)
Enzymes [BR:senj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CFSAN001992_13155 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AGF82929
Position
complement(2704252..2705142)
Genome map
AA seq 296 aa AA seqDB search
MSFFHANQREALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTY
GANSGERDRTHSVIKGIKERTGLEAAPHLTCIDATRDELRTIARDYWNNGIRHIVALRGD
LPPGSGKPEMYAADLVGLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRA
ITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPSWMSLMFE
GLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPGL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttttcacgccaaccagcgggaagccctgaatcagagcctggcggaagtacag
ggtcagattaacgtttcgtttgaatttttcccgccgcgcaccagtgaaatggagcaaacc
ctgtggaactccatcgatcgcctgagcagtctgaaaccgaagtttgtttcggtaacgtat
ggcgccaactccggggaacgcgaccgcactcatagcgttattaaaggcattaaagagcgt
actgggcttgaggccgcgccgcaccttacctgtattgacgccacgcgcgatgaactgcgc
accatcgcccgcgactactggaataacggtatccgccacattgtcgctttgcgcggcgat
ttgccgccgggcagcggtaagccggagatgtacgccgccgatctggttggtttgctcaaa
gaggtggccgatttcgatatttcagtagcggcctatccggaggtacatccggaagcgaaa
agcgcgcaggccgatctgcttaatctgaagcgtaaagtggatgctggcgctaaccgcgcg
ataacccaatttttcttcgatgtggaaagctatctgcgttttcgtgaccgctgtgtttcc
gccggtatcgacgtagaaattattcccggcattttaccggtgtctaattttaaacaggcg
aaaaaatttgccgatatgaccaatgtccgcattccgtcctggatgtcactgatgtttgag
gggctggatgatgacgcagaaacccgcaagctggtgggcgctaacattgcgatggacatg
gtgaaaattttaagccgcgaaggagtgaaggatttccacttctacacgttgaatcgtgcg
gaaatgagttatgccatttgccacacgctgggcgtaagacccggtttataa

DBGET integrated database retrieval system