KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_15210Help
Entry
CFSAN001992_15210 CDS       T02479                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
senj00051  Fructose and mannose metabolism
senj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CFSAN001992_15210
Enzymes [BR:senj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CFSAN001992_15210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: AGF83326
Position
complement(3138854..3140002)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENEQVDTV
SGVNAVSSIGDDVVDLIAHVDLITTAVGPVVLERIAPAIAKGLVKRKAQGVDAPLNIIAC
ENMVRGTTQLKGHVMNALADGDKAWVEQHVGFVDSAVDRIVPPSASATHDPLEVTVETFS
EWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DESIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHVNLVKGIAAAMHFRSEEDPQAQELAALIDEKGPQAALAQ
ISGLDANSDVVAEAVNAYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggcaaactgctg
gctgacgcggggatacaactgacgtttgcggatgtaaaccaggtcgtactcgatgccctg
aatgcccgtcatagctatcaggttcatgttgtgggtgaaaatgagcaggtggataccgtt
tccggcgtcaacgctgtcagcagcatcggcgatgatgttgtcgacctgattgcccacgtt
gatttaatcactactgccgtgggtccggttgtgcttgagcgtatcgctccggccatcgct
aaagggctggtaaaacgtaaggcgcagggcgtggatgccccgctgaatatcatcgcctgt
gaaaatatggtgcgcggcaccacacagctcaaaggtcatgtgatgaacgcgctggcggat
ggcgataaagcctgggttgaacagcacgtcggttttgtggattccgccgttgaccgtatt
gtgccgccatctgcttccgccacccatgacccgctggaagtgacggtagaaaccttcagc
gagtggatcgtcgataaaacccagtttaaaggcgcgttgccgaccattccggggatggag
ttaacggataacctgatggcatttgtcgaacgtaaactcttcacgctgaacacaggtcat
gctataaccgcgtacctcggcaaattagccggtcatcaaaccattcgcgacgccattctc
gatgagagtattcgcgcggtggttaaaggcgcgatggaagaaagcggcgcggtgctgatc
aaacgctacggttttgacgccgacaaacatgcggcatacattcagaaaatcctcggtcgt
tttgaaaacccgtatctgaaagatgatgttgagcgcgttggacgtcagccgctacgcaaa
ctcagcgcgggcgaccgtctgatcaaaccgctgcttggcaccctggaatatggtctgccg
catgtgaatctggtcaaagggatcgcggcggcgatgcatttccgcagtgaagaagatccg
caggcacaggaactggccgcgctgattgacgaaaaaggtccacaggccgctctggcgcaa
atttccgggctggatgccaatagcgatgtggtggcggaggcggttaacgcttataacgcg
accaaatga

DBGET integrated database retrieval system