KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_16070Help
Entry
CFSAN001992_16070 CDS       T02479                                 

Gene name
ompR
Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
senj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:senj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFSAN001992_16070 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:senj02022]
    CFSAN001992_16070 (ompR)
Two-component system [BR:senj02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   CFSAN001992_16070 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AGF83496
Position
3342213..3342932
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaattataagattctggtggttgatgacgatatgcgtctgcgggcgctactg
gaacgttatctgaccgagcagggcttccaggttcgaagcgtcgctaacgccgagcagatg
gatcgtctgctgacccgtgaatctttccatctcatggtactggatttaatgctgccaggt
gaagatggtctgtcgatttgtcgtcgcctgcgtagtcaaagtaatccaatgccgatcatt
atggtcacggcgaagggtgaagaggttgaccgtatcgtcgggctggaaatcggcgccgat
gactacattcctaaaccgtttaacccgcgcgagctgttggcgcgtatccgcgccgtgcta
cgtcgtcaggcaaacgaactgcccggcgcgccgtcgcaggaagaggccgttatcgcgttc
ggtaagtttaaactgaacctcggtacgcgcgagatgttccgtgaagatgaaccgatgccg
ctgaccagcggggagtttgcggtactgaaagcgctggtaagccacccgcgcgagccgctc
tctcgcgataagctgatgaatctggcccgtggccgcgagtattccgcgatggaacgctcc
atcgacgtccagatctcccgcctgcgccgtatggtggaagaagatccggcgcatccgcgt
tatattcagaccgtctggggcctgggctacgtcttcgtaccggacggttctaaagcatga

DBGET integrated database retrieval system