KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_16790Help
Entry
CFSAN001992_16790 CDS       T02479                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
senj00620  Pyruvate metabolism
senj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFSAN001992_16790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:senj02000]
    CFSAN001992_16790
Enzymes [BR:senj01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     CFSAN001992_16790
Transporters [BR:senj02000]
 Other transporters
  Primary active transporters [TC:3]
   CFSAN001992_16790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 F_bP_aldolase Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AGF83640
Position
3479847..3481622
Genome map
AA seq 591 aa AA seqDB search
MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAQLDDVGYGSLECWGGATFDACIRFLGED
PWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMNA
PRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAFELVSEIKKRFEVRLHLHCHATTGMAEMALQKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEGQLKGYDSRILVAQVPGGML
TNLESQLKQQNAADKLDLVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQAHVLEGAAPVTCRPADLLKPELAELEADVRRQAQEK
GIQLAGNAIDDVLTVALFPQPGLKFLENRHNPAAFEPLPQAEAAQPVAKAEKPAASGIYT
VEVEGKAFVVKVSDGGDISQLTAAEPAASSAPVQAAAPAGAGTPVTAPLAGNIWKVIAAE
GQTVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGDAVSVGDTLMTLA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgccattaccgatgtcgtcctgcgcgacgcccaccagtctctgttcgccacc
cgcctgcgccttgacgatatgctgccgattgccgctcagcttgacgatgtcggctacggc
tcgctggagtgctggggcggtgcgacctttgacgcctgcattcgctttctcggcgaagac
ccgtggctgcgcctgcgcgaactcaaaaaagccatgcccaaaaccccgctgcagatgctg
ctgcgtggccagaacctgctcggctaccgccactacgccgatgacgtggtggagcgtttt
gtcgaacgcgcggtgaaaaacggcatggacgtcttccgcgtcttcgatgccatgaacgcc
ccgcgcaatatgaaagccgccctgcaggcggtgcgcagccacggcgcccacgcccagggc
acgctctcttacaccaccagcccggcccacaccctgcagacctggctggatttaacggag
caactgctggaaaccggcgttgactcgattgccatcaaggatatgtccggcatcctgacg
ccgatggccgcctttgagctggtcagtgaaatcaaaaaacgttttgaggtgcgcctgcac
ctgcactgtcacgccaccaccgggatggcggagatggccctgcagaaggctatcgaggcg
ggcgttgacggcgtcgacacggcgatttcctccatgagcgccacctacggccacccggcc
accgaggcgctggtggcgacgttggcaggtactgagcacgacaccgggctggatatcctg
aaactggaaaacatcgccgcgtacttccgcgaggtgcgcaagaaataccacgcctttgaa
ggccagctgaagggctacgacagccgcattctggtggcccaggtgccgggcggaatgctg
accaacctcgaaagccagctgaagcagcagaacgcggcggacaaactcgacctggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggttttatcccgctggtgacccccacctcg
cagattgtcggcacccaggcggtgctcaacgtcctgaccggcgaacgctacaaaaccatt
gccaaagaaacggcgggcattctgaaaggcgaatacggccacaccccggtgccggtgaac
gcggcactgcaggcccacgtgctggaaggggcagccccggtgacctgccgtccggcggat
ttactcaaaccggaactggctgaactggaagcggacgtcaggcgccaggcgcaggagaag
ggcatccagcttgcgggaaacgccattgacgacgtcctcaccgtggcgctgttcccgcaa
cccggcctcaaattccttgagaaccgccacaatccggcggcgtttgagccactgccgcag
gcggaagccgcgcagccggtggcaaaagcagagaagcctgccgcctccggtatctacacc
gtggaagtggaaggcaaagcctttgtggtgaaggtcagcgacggcggcgatatcagccag
cttactgcggctgaaccggcggcctcttccgcaccggttcaggccgccgcccccgcaggc
gcaggcaccccggtcaccgccccgctggcggggaatatctggaaggtgattgccgctgaa
ggccagacggtggccgaaggcgacgtgctgctgattctggaagccatgaagatggaaacc
gaaatccgcgccgcgcaggccgggacggtacgcggtatcgcggtgaagtccggggacgcg
gtctctgtgggcgacaccctgatgacgctggcgtaa

DBGET integrated database retrieval system