KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_18475Help
Entry
CFSAN001992_18475 CDS       T02479                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
senj00071  Fatty acid degradation
senj00280  Valine, leucine and isoleucine degradation
senj00310  Lysine degradation
senj00362  Benzoate degradation
senj00380  Tryptophan metabolism
senj00620  Pyruvate metabolism
senj00630  Glyoxylate and dicarboxylate metabolism
senj00640  Propanoate metabolism
senj00650  Butanoate metabolism
senj00900  Terpenoid backbone biosynthesis
senj01100  Metabolic pathways
senj01110  Biosynthesis of secondary metabolites
senj01120  Microbial metabolism in diverse environments
senj01130  Biosynthesis of antibiotics
senj01200  Carbon metabolism
senj01212  Fatty acid metabolism
senj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:senj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFSAN001992_18475
   00630 Glyoxylate and dicarboxylate metabolism
    CFSAN001992_18475
   00640 Propanoate metabolism
    CFSAN001992_18475
   00650 Butanoate metabolism
    CFSAN001992_18475
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFSAN001992_18475
   00072 Synthesis and degradation of ketone bodies
    CFSAN001992_18475
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFSAN001992_18475
   00310 Lysine degradation
    CFSAN001992_18475
   00380 Tryptophan metabolism
    CFSAN001992_18475
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFSAN001992_18475
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFSAN001992_18475
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFSAN001992_18475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senj04147]
    CFSAN001992_18475
Enzymes [BR:senj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFSAN001992_18475
Exosome [BR:senj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFSAN001992_18475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGF83973
Position
3820140..3821318
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLAEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtactgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgacaaccgtttcc
gccattaccattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttatcgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgatagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagctctgctgcacccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactggcggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcctattggcgcttccggctgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggcctggcgacgctgtgtattggt
ggcggccagggcgttgctttaaccattgaacgcgattga

DBGET integrated database retrieval system