KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_08080Help
Entry
IY59_08080        CDS       T03817                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Pathway
senl00250  Alanine, aspartate and glutamate metabolism
senl00650  Butanoate metabolism
senl00760  Nicotinate and nicotinamide metabolism
senl01100  Metabolic pathways
senl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:senl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    IY59_08080
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IY59_08080
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    IY59_08080
Enzymes [BR:senl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     IY59_08080
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     IY59_08080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PSD4
Motif
Other DBs
NCBI-ProteinID: AIN05282
UniProt: A0A1R2UA00
Structure
PDB: 

Position
complement(1626519..1627907)
Genome map
AA seq 462 aa AA seqDB search
MTMMTATQALSVNPATGQTLAAMPWANAQEIEHALSLAASGFKKWKMTSVAQRAQTLRDI
GQALRAHAEEMAQCITREMGKPIKQARAEVTKSAALCDWYAEHGPAMLNPEPTLVENQQA
VIEYRPLGVILAIMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQMIARILTEAG
TPAGVYGWVNANNEGVSQMINDPRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTDRFVAAAAALKIGDP
LVEENDLGPMARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVTPDMT
AFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEMAARLECGGVFIN
GYSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKNRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgatgactgcaacacaggcgttatccgttaatcctgcgaccggccagacgctg
gcggcaatgccctgggctaacgcgcaagagattgaacatgcgctgagtctggcggcgagc
ggtttcaaaaagtggaaaatgacatcagtagcgcaacgggcgcaaacattacgcgatatt
ggtcaggcgcttcgcgctcatgcagaagagatggcgcaatgtattacgcgtgaaatgggt
aaacccataaagcaggcgcgtgcggaagtgacgaaatccgccgcgttatgcgactggtat
gcggaacatggcccggcaatgctgaatcctgagcctacgctggtagaaaatcagcaggcg
gtgattgaataccgtccgctgggcgtcattctggcgataatgccgtggaattttccttta
tggcaggtgttacgcggggcagtgccgatactgttggcggggaatagctacttgttaaaa
catgcgcccaatgtcacgggttgcgcgcagatgatagcccgaatcttgacggaagccggt
actcccgctggcgtctatggatgggtgaacgccaataatgagggcgtgagtcagatgatt
aacgatccgcgaatcgcggcggtgacggtgaccggtagcgtgcgcgccggcgcggcgatt
ggcgctcaggctggggcggcgctgaaaaagtgcgtactggaactggggggctcggatccg
tttattgtactcaatgatgccgatctcgagctggcggtaaaagctgcggttgcaggacgc
tatcaaaacaccggacaagtctgcgccgccgccaaacgttttattgtcgaagagggcatt
gcgcaggcgtttaccgatcgttttgtggcggctgccgcagcattaaagataggtgatcct
ctggttgaagagaatgacctggggccgatggcgcgctttgatttgcgtgatgaactccat
caacaggtgcaggcttccgtcgccgaaggcgcacggctactgttgggcggggagaaaatc
gccggggagggcaactattatgccgcgaccgttctggcggatgttacacctgacatgact
gcatttcgtcaggaactttttgggcctgttgccgccattaccgtcgcaaaagatgcggcg
cacgccctcgcgctggcgaatgacagtgagtttggcctgtcggcgacgatctttaccgcc
gacgatacgctggccgcggagatggcggcgcgtcttgagtgcggcggggtattcattaat
gggtacagcgccagcgatgcgcgtgtggcattcggcggggtgaagaaaagtggcttcggt
cgcgagctttcgcactttggtttacacgaattttgtaatgtgcagaccgtctggaagaac
cgcgtctaa

DBGET integrated database retrieval system