KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_11160Help
Entry
IY59_11160        CDS       T03817                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Pathway
senl00450  Selenocompound metabolism
senl00970  Aminoacyl-tRNA biosynthesis
senl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    IY59_11160 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IY59_11160 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:senl01007]
    IY59_11160 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:senl03016]
    IY59_11160 (metG)
Enzymes [BR:senl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     IY59_11160 (metG)
Amino acid related enzymes [BR:senl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   IY59_11160 (metG)
Transfer RNA biogenesis [BR:senl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    IY59_11160 (metG)
 Prokaryotic type
   Other AARSs
    IY59_11160 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIN05867
UniProt: A0A1R2W2B3
Position
2212453..2214486
Genome map
AA seq 677 aa AA seqDB search
MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIM
LKAQQLGITPEQMIGEMSQEHQTDFAGFNISYDNYHSTHSDENRELSELIYTRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSADQYGDNCEVCGATYSPTELIEPKSVVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTTSFDEYWKKDSDAELYHFIGKDIVY
FHSLFWPAMLEGSHFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLKHFDADSLRYYY
TAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFINKRFDGVLAAELADPQLYK
TFTDAAAVIGEAWESREFGKAIREIMALADVANRYVDEQAPWVVAKQEGRDADLQAICSM
GINLFRVLMTYLKPVLPTLSERVEAFLNSELNWDAIEQPLLSHKVNTFKALYNRIDMKQV
EALVEASKEEVKAAAAPVTGPLADFPIQETITFDDFAKIDLRVALIENAEFVEGSDKLLR
LTLDLGGEKRNVFSGIRSAYPDPQALIGRQTVMVANLAPRKMRFGVSEGMVMAAGPGGKD
IFLLSPDDGAKPGQQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaagaaaattctggtaacgtgcgcgctgccgtacgccaacggctct
atccacctcggccatatgctggagcacatccaggctgatgtctgggtccgttaccagcga
atgcgcggccatgaggttaacttcatctgtgccgatgacgctcatggcacgccgatcatg
ctgaaagcgcagcagcttggtattacgccggagcaaatgatcggtgaaatgagccaggag
caccagaccgatttcgccggttttaatattagctacgacaactaccactcaacgcacagc
gacgagaatcgcgagctgtccgagctgatttatacgcgcctgaaagagaacggttttatt
aagaaccgcactatctctcaactctacgatccggaaaaaggcatgttcctgccggaccga
tttgtgaaaggcacctgcccgaaatgtaaatccgcggaccagtacggcgataactgtgaa
gtctgcggcgcaacttacagcccgaccgaacttatcgagccgaaatccgtggtgtccggc
gcgacgccggtaatgcgtgactccgagcactttttctttgatctgccgtcattcagcgaa
atgctgcaggcgtggacccgcagcggcgcgctgcaggagcaggtggcgaacaaaatgcag
gagtggtttgaatccggcctgcaacagtgggacatttcccgcgacgcgccgtattttggt
ttcgaaatcccgaacgcgccgggcaaatatttctacgtctggctggacgcgccgattggc
tatatgggctccttcaaaaatctgtgcgataagcgcggtgacacgaccagttttgatgag
tactggaaaaaagactccgacgccgagctgtatcactttatcggcaaagacatcgtctat
ttccacagcctgttctggcctgccatgctggaaggcagccacttccgtaagccgaccaac
ctgttcgttcacggttacgtgacggtgaacggcgcgaagatgtctaagtctcgcggcacc
tttattaaggccagcacctggctgaaacactttgacgccgacagcctgcgctactactac
accgcgaagctttcttcacgcattgatgacatcgacctgaacctggaagactttgtccag
cgcgtcaatgccgatatcgtcaataaagtagtcaacctggcatcccgtaacgccggtttt
atcaataagcgtttcgacggcgtgctggcggctgaactggccgatccgcaattgtacaaa
acctttactgacgccgctgcggtgattggcgaagcatgggaaagccgtgaattcggcaaa
gctatccgtgagattatggcgctggccgacgtcgctaaccgttatgttgacgagcaagcg
ccgtgggtggtggctaaacaggaaggccgcgacgctgacctgcaggccatttgctcgatg
ggcatcaacctgttccgcgtgctgatgacgtatctgaaaccggtactgccgacgctttct
gaacgcgttgaagccttcctgaacagcgaactgaactgggatgccatcgaacagccgctg
ctcagtcacaaggtcaacacctttaaggcgctctacaatcgcatcgacatgaagcaagtt
gaagcgctggttgaagcgtctaaagaagaggtgaaagccgcagccgcaccggttaccggc
ccgttagccgacttcccgattcaggaaaccatcacctttgacgatttcgccaaaattgac
ctgcgcgtagcattgattgaaaacgctgagttcgtggaaggctccgacaaattgctgcgt
ctgacgctggatctgggcggcgagaagcgtaacgtcttctccggcattcgttccgcctac
ccggacccgcaggcgctgatcggccgccagacggtaatggtcgccaacctcgcgccgcgc
aaaatgcgctttggcgtctccgagggaatggtgatggccgcaggccctggcgggaaagat
atcttcctgttaagccctgatgacggcgcgaagcctggccaacaggtgaaataa

DBGET integrated database retrieval system