KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_15145Help
Entry
IY59_15145        CDS       T03817                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Pathway
senl00071  Fatty acid degradation
senl00280  Valine, leucine and isoleucine degradation
senl00310  Lysine degradation
senl00362  Benzoate degradation
senl00380  Tryptophan metabolism
senl00620  Pyruvate metabolism
senl00630  Glyoxylate and dicarboxylate metabolism
senl00640  Propanoate metabolism
senl00650  Butanoate metabolism
senl00900  Terpenoid backbone biosynthesis
senl01100  Metabolic pathways
senl01110  Biosynthesis of secondary metabolites
senl01120  Microbial metabolism in diverse environments
senl01130  Biosynthesis of antibiotics
senl01200  Carbon metabolism
senl01212  Fatty acid metabolism
senl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:senl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IY59_15145
   00630 Glyoxylate and dicarboxylate metabolism
    IY59_15145
   00640 Propanoate metabolism
    IY59_15145
   00650 Butanoate metabolism
    IY59_15145
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IY59_15145
   00072 Synthesis and degradation of ketone bodies
    IY59_15145
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IY59_15145
   00310 Lysine degradation
    IY59_15145
   00380 Tryptophan metabolism
    IY59_15145
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IY59_15145
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IY59_15145
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IY59_15145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senl04147]
    IY59_15145
Enzymes [BR:senl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IY59_15145
Exosome [BR:senl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IY59_15145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIN06629
UniProt: A0A2R4HMG1
Position
complement(3061725..3062903)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattactattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system