KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_10270Help
Entry
SN31241_10270     CDS       T02779                                 

Definition
(GenBank) FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase
  KO
K03774  FKBP-type peptidyl-prolyl cis-trans isomerase SlpA [EC:5.2.1.8]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Brite
KEGG Orthology (KO) [BR:senn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:senn03110]
    SN31241_10270
Enzymes [BR:senn01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SN31241_10270
Chaperones and folding catalysts [BR:senn03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    SN31241_10270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: AGS28001
Position
1043951..1044400
Genome map
AA seq 149 aa AA seqDB search
MSKSVQSNSAILVHFTLKLDDGSTAESTRNNGKPALFRLGDTSLSEGLEQQLLGLKEGEK
KAFSLEPDAAFGVPSPDLIQYFSRREFMAAGEPEVGAIMLFTAMDGSEMPGVIREINGDS
ITVDFNHPLAGHTVHFDIEVLEIDPVLEA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatccgtacagagcaacagcgcgatcctcgttcacttcaccctgaaactggat
gatggctcaacggcggaatctacccgcaataacggcaagccagccctgttccgtcttggc
gatacctcgctttccgaaggtctggagcagcagcttctggggttgaaagaaggggaaaag
aaagcgttttcgctggagcctgacgccgcgtttggcgtccccagtccggacttgatccag
tatttctcgcgccgtgagtttatggcggcgggcgaaccggaagtcggggcgattatgctt
tttaccgcaatggatggcagcgaaatgcctggcgtgattcgcgaaatcaacggcgactcg
attaccgttgattttaaccatccgctggccgggcataccgttcactttgatattgaagtg
ctggaaatcgatccggtgctggaggcataa

DBGET integrated database retrieval system