KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_15820Help
Entry
SN31241_15820     CDS       T02779                                 

Definition
(GenBank) Oxygen-insensitive NADPH nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00633  Nitrotoluene degradation
senn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SN31241_15820
Enzymes [BR:senn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     SN31241_15820
  1.-  
   1.-.-  
    1.-.-.-  
     SN31241_15820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase DSBA
Motif
Other DBs
NCBI-ProteinID: AGS28555
Structure
PDB: 

Position
complement(1628024..1628677)
Genome map
AA seq 217 aa AA seqDB search
MDIVSVALKRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAANYVFNERKMLDASHVVVFCAKTAMDDAWLERVVDQEEADGRFATPEAKAANDKG
RRFFADMHRVSLKDDHQWMAKQVYLNVGNFLLGVAAMGLDAVPIEGFDAEVLDAEFGLKE
KGYTSLVVVPVGHHSVEDFNAGLPKSRLPLETTLTEV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtttctgtcgccttaaagcgctactccactaaggcgttcgatcccagcaaa
aaactgaccgccgaagaagcggataaaataaaaacactactacagtacagcccctccagc
accaattcccagccgtggcactttattgtcgccagtacggaagagggcaaagcgcgcgta
gcaaaatccgccgccgccaattatgtgtttaacgaacgtaaaatgttagacgcctcccat
gtggtggtcttctgcgcgaaaaccgcgatggatgacgcatggcttgagcgcgtcgtcgat
caggaagaagccgatggccgtttcgctacgccggaagctaaagcggcaaatgataaaggt
cgccgctttttcgccgatatgcaccgcgtctcgctgaaagatgaccaccagtggatggcg
aagcaggtttatctgaacgtcggcaactttctgctgggcgtcgccgcgatgggtctcgac
gctgtccccattgaaggtttcgacgccgaggtgctcgacgctgaatttggtctgaaagaa
aaaggctataccagtctggtcgtggtgccggtcggccatcatagcgtcgaggatttcaac
gccgggctgccgaaatcacgtctgccgcttgaaaccacactgacggaagtctaa

DBGET integrated database retrieval system