KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_16490Help
Entry
SN31241_16490     CDS       T02779                                 

Definition
(GenBank) Alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00860  Porphyrin and chlorophyll metabolism
senn01100  Metabolic pathways
Module
senn_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SN31241_16490
Enzymes [BR:senn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     SN31241_16490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGS28622
Position
complement(1696058..1696651)
Genome map
AA seq 197 aa AA seqDB search
MRHGETEANVAGLYSGHAPTPLTENGIGQAKTLHTLLRHAPFDRVLCSELERARHTARLV
LEGRDTPQHILPELNEMYFGDWEMRHHRDLAHEDAESYAAWCTDWQNAVPTNGEGFQAFT
RRVERFISRLDAFSDCQNLLIVSHQGVLSLLIARLLAMPAASLWHFRVEQGCWSAIDICE
GFATLKVLNSRAVWRPE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcatggcgaaaccgaggctaatgtcgccgggttgtatagcggacatgctcccacg
ccgttaacggaaaatgggattggccaggcgaaaacgctacatactttattgcgccacgcg
ccatttgaccgggtgttatgcagcgagctggaacgcgcgcgccataccgcccggctcgta
ctggagggccgggatacgccgcaacacatcttacctgagcttaatgagatgtacttcggc
gactgggaaatgcgccatcaccgcgacctcgcccatgaagatgccgaaagctatgccgcc
tggtgtacggactggcagaatgcggttccgaccaatggcgagggttttcaggcttttacc
cggcgcgtagagcgctttatctcgcgactcgacgcgttcagcgattgccagaacctgctg
atcgtcagccatcagggcgtactcagcctgttgattgcccgtctgctcgcaatgcccgcc
gcctcgctatggcatttccgggtagaacagggatgctggagcgcaatcgacatatgcgaa
gggttcgccaccctgaaagtattaaatagtcgtgccgtctggcggcctgagtga

DBGET integrated database retrieval system