KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_1700Help
Entry
SN31241_1700      CDS       T02779                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00540  Lipopolysaccharide biosynthesis
senn01100  Metabolic pathways
Module
senn_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SN31241_1700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:senn01005]
    SN31241_1700
Enzymes [BR:senn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     SN31241_1700
Lipopolysaccharide biosynthesis proteins [BR:senn01005]
 Unusual sugar
  SN31241_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR adh_short
Motif
Other DBs
NCBI-ProteinID: AGS27145
Position
complement(172081..173013)
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQI
MSGEELGDIEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATY
GGRTSDFIESREYEKPLNVYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGESPKLFEGSENFKRDFVYVGDVAAVNLWFLESGKSGIFNLGTGRA
ESFQAVADATLAYHKKGSIEYIPFPDKLKGRYQAFTQADLTNLRNAGYDKPFKTVAEGVT
EYMAWLNRDS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttaccggcggcgcgggctttatcggcagcaatatcgttaaggccctgaat
gataaaggtatcaccgatattctggtggtggataacctgaaagacggcaccaagtttgta
aacctggtggatctgaacattgctgactatatggataaggaagatttcctgatccagatt
atgtccggagaagagctcggcgatatcgaagctattttccatgaaggcgcctgctcttcc
accaccgagtgggacggcaagtatatgatggataataactatcaatactccaaagagctg
ctgcactattgtcttgagcgcgaaatcccgttcctctatgcctcttctgccgccacctat
ggcggtcgcacgtctgatttcatcgaatcgcgcgaatacgaaaaaccgcttaacgtttac
ggctattctaaattcctgtttgatgaatatgtgcgccagatcctgccagaagcgaactcg
cagattgtcggtttccgctatttcaacgtctatggaccacgtgaaggccataaaggcagc
atggcaagcgtggcatttcatctgaatacacagttaaacaacggcgaaagcccgaaactg
tttgaaggcagcgaaaacttcaagcgcgacttcgtttacgtgggcgatgtggccgccgtt
aacctgtggttcctggaaagcggcaagtccggcatctttaacctgggcacaggccgtgcg
gaatctttccaggccgtcgccgacgcgacgctggcataccataaaaaaggcagcattgaa
tacattccgttcccggataagctgaaaggtcgctatcaggcgtttacgcaggcggattta
accaatctgcgcaacgcgggctacgacaaaccctttaagaccgtcgccgaaggcgtcacg
gagtatatggcctggctgaaccgcgactcgtaa

DBGET integrated database retrieval system