KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_28320Help
Entry
SN31241_28320     CDS       T02779                                 

Definition
(GenBank) Aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00010  Glycolysis / Gluconeogenesis
senn00071  Fatty acid degradation
senn00350  Tyrosine metabolism
senn00620  Pyruvate metabolism
senn00625  Chloroalkane and chloroalkene degradation
senn00626  Naphthalene degradation
senn00650  Butanoate metabolism
senn01100  Metabolic pathways
senn01110  Biosynthesis of secondary metabolites
senn01120  Microbial metabolism in diverse environments
senn01130  Biosynthesis of antibiotics
senn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SN31241_28320
   00620 Pyruvate metabolism
    SN31241_28320
   00650 Butanoate metabolism
    SN31241_28320
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SN31241_28320
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SN31241_28320
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SN31241_28320
   00626 Naphthalene degradation
    SN31241_28320
Enzymes [BR:senn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SN31241_28320
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SN31241_28320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: AGS29804
Position
2864302..2866980
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYMLQGQELKAVQNVILKNGALNAAIVGQP
AYKIAELAGFSVPETTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEEAVEKAEKLV
AMGGIGHTSCLYTDQDNQPERVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDFTEGEVAAKKDVVAAPKAEKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaggtcgacaaaatcttccgcgccgccgctctg
gcagccgctgatgcccgcattccgctggccaaaatggccgtcgccgaatccggtatgggt
atcgtggaagacaaagtgattaaaaaccacttcgcttctgaatatatttacaatgcctat
aaagatgaaaaaacctgcggcgtgctgtctgaagacgacaccttcggaaccatcaccatt
gctgaacctatcggcattatttgcggtatcgttccaaccactaacccgacctctaccgcg
atcttcaaatcgctgattagcctgaagacccgtaacgccatcatcttttctccgcatccg
cgcgctaaagaagcaaccaacaaagcggcagacatcgttctgcaagcggctatcgctgcc
ggcgcgccgaaagatctgattggctggatcgatcaaccttccgtagaactgtctaatgcg
ctgatgcaccacccggatatcaacctgatcctcgccactggcggtccaggcatggttaaa
gcagcatacagctccggtaaacctgctatcggcgtaggcgcaggcaacaccccggttgtc
attgatgaaaccgcggatatcaaacgcgctgtggcgtctgttctgatgtctaaaaccttc
gataacggcgtaatctgtgcttctgaacagtctgttgtcgttgttgattccgtctatgat
gccgttcgcgaacgtttcgccagccacggcggctacatgctgcagggccaggagctgaaa
gcggttcaaaacgttatcctgaaaaatggcgctctgaacgccgctatcgtcggccagcca
gcctacaaaatcgctgaactggcaggcttctccgtaccagaaaccaccaagattctgatc
ggtgaagttacggtcgttgacgaaagcgaaccgttcgcacacgaaaaactgtctccgact
ctggcgatgtatcgtgcgaaagatttcgaagaagcggtagaaaaagcagaaaaactggtc
gctatgggcggtatcggtcacacctcctgcctgtacactgaccaggataaccagccagaa
cgcgttgcttacttcggtcagatgatgaaaaccgcgcgtatcctgatcaacaccccggcc
tctcagggtggtatcggtgacctgtacaacttcaaactcgcaccttccctgacgttgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctctctgcccatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgcttcctgttcaacaacggctacgcagaccagatcacc
tctgtgctgaaagcggctggcgttgaaaccgaagtcttcttcgaagttgaagccgacccg
acgctttccgttgttcgcaaaggcgctgagctggctaactccttcaaaccagacgtgatc
atcgcgctgggcggtggttccccgatggacgccgcgaaaatcatgtgggtcatgtacgaa
catccggaaactcacttcgaagagctggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcaccaccacttccggt
accggttctgaagtcacaccgtttgcggttgtgaccgacgatgcaaccggtcagaaatat
ccgctggctgactacgccctgaccccggatatggcgattgtcgatgccaacctggtgatg
gatatgccgaagtccctgtgtgcgttcggtggtctggatgcggtaactcacgccctggaa
gcttacgtttccgtactggcttctgagttctctgacggtcaggctctgcaggctctgaaa
ctgctgaaagaaaacctgccggcgtcttaccacgaagggtctaaaaacccggttgcgcgt
gaacgtgttcacagtgcagcgactatcgccggtatcgcgtttgccaacgccttcctcggt
gtatgtcactccatggcgcacaaactgggctctcagttccacattccgcacggtctggcg
aacgccctgctgatttgtaacgttatccgctacaacgcgaatgacaacccgaccaagcag
accgctttcagccagtacgatcgtccgcaggcacgccgtcgttacgctgaaattgctgac
cacctgggcctgagcgcgccgggcgaccgtaccgccgctaagattgaaaaactgctggca
tggctggaaagcattaaagctgagctgggtattcctaagtctatccgtgaagcaggcgta
caggaagctgacttcctggcacacgttgacaaactgtctgaagatgccttcgatgaccag
tgcaccggcgctaacccgcgttatccactgatctccgaactgaaacagattctgctggat
acctactacggtcgtgatttcaccgaaggtgaagttgcagcgaagaaagacgtcgttgcc
gcaccgaaagcagagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system