KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_32660Help
Entry
SN31241_32660     CDS       T02779                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00450  Selenocompound metabolism
senn00970  Aminoacyl-tRNA biosynthesis
senn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SN31241_32660
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SN31241_32660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:senn01007]
    SN31241_32660
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:senn03016]
    SN31241_32660
Enzymes [BR:senn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SN31241_32660
Amino acid related enzymes [BR:senn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SN31241_32660
Transfer RNA biogenesis [BR:senn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SN31241_32660
 Prokaryotic type
   Other AARSs
    SN31241_32660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGS30238
Position
3286561..3288594
Genome map
AA seq 677 aa AA seqDB search
MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIM
LKAQQLGITPEQMIGEMSQEHQTDFAGFNISYDNYHSTHSDENRELSELIYTRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSADQYGDNCEVCGATYSPTELIEPKSVVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTTSFDEYWKKDSDAELYHFIGKDIVY
FHSLFWPAMLEGSHFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLKHFDADSLRYYY
TAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFINKRFDGVLAAELADPQLYK
TFTDAAAVIGEAWESREFGKAIREIMALADIANRYVDEQAPWVVAKQEGRDADLQAICSM
GINLFRVLMTYLKPVLPTLSERVEAFLNSELNWDAIEQPLLGHKVNTFKALYNRIDMKQV
EALVEASKEEVKAAAAPVTGPLADFPIQETITFDDFAKIDLRVALIENAEFVDGSDKLLR
LTLDLGGEKRNVFSGIRSAYPDPQALIGRQTVMVANLAPRKMRFGVSEGMVMAAGPGGKD
IFLLSPDDGAKPGQQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaagaaaattctggtaacgtgcgcgctgccgtacgccaacggctct
atccacctcggccatatgctggagcacatccaggctgatgtctgggtccgttaccagcga
atgcgcggccatgaggttaacttcatctgtgccgatgacgctcatggcacgccgatcatg
ctgaaagcgcagcagcttggtattacgccggagcaaatgatcggtgaaatgagccaggag
caccagaccgatttcgctggttttaatattagctacgacaactaccactcaacgcacagc
gacgagaatcgcgagctgtccgagctgatttatacgcgcctgaaagagaacggttttatt
aagaaccgcactatctctcaactctacgatccggaaaaaggcatgttcctgccggaccga
tttgtgaaaggcacctgcccgaaatgtaaatccgcggaccagtacggcgataactgtgaa
gtctgcggcgcaacttacagcccgaccgaacttatcgagccgaaatccgtggtgtccggc
gcgacgccggtaatgcgtgactccgagcactttttctttgatctgccgtcattcagcgaa
atgctgcaggcgtggacccgcagcggtgcgctgcaggagcaggtggcgaacaaaatgcag
gagtggtttgaatccggcctgcagcagtgggacatttcccgcgacgcgccgtattttggt
ttcgaaatcccgaacgcgccgggcaaatatttctacgtctggctggacgcgccgattggc
tatatgggttccttcaaaaatctgtgcgataagcgcggtgacacgaccagttttgatgag
tactggaaaaaagactccgatgccgaactgtaccactttatcggcaaagacatcgtctat
ttccatagcctgttctggcctgccatgctggaaggcagccacttccgtaagccgaccaac
ctgttcgttcacggttacgtgacggtgaacggcgcgaagatgtctaagtctcgcggcacc
tttattaaggccagcacctggctgaaacactttgacgccgacagcctgcgctactactac
accgcgaagctttcttcacgcattgatgacatcgacctgaacctggaagactttgtccag
cgcgtcaatgccgatatcgtcaataaagtagtcaacctggcctcgcgtaacgccggtttt
atcaataagcgtttcgacggcgtgctggcggctgaactggccgatccgcaattgtataaa
acctttactgacgccgctgcggtgattggcgaagcatgggaaagccgtgaattcggtaaa
gctatccgtgagattatggcgctggccgacatcgctaaccgttatgttgacgagcaagcg
ccgtgggtggtggctaaacaagaaggccgcgacgcggacctgcaggccatttgctcaatg
ggcatcaacctgttccgcgtgctgatgacgtatctgaaaccggtactgccgacgctttct
gaacgcgttgaagccttcctgaacagtgagttgaactgggatgccatcgaacagccgctg
ctcggtcacaaggtcaacacctttaaggcgctctacaatcgcatcgacatgaagcaagtt
gaagcgctggttgaagcgtctaaagaagaggtgaaagccgcagctgcgccggttaccggc
ccgttagccgacttcccgattcaggaaaccatcacctttgacgatttcgccaaaattgac
ctgcgcgtagcattgattgaaaatgctgagttcgtagacggttctgacaaattgctgcgc
ctgacgctggatctgggcggcgagaagcgtaacgtcttctccggcattcgttccgcctac
ccggacccgcaggcgctgattggccgccagacggtaatggtcgccaacctcgcgccgcgc
aaaatgcgctttggcgtctccgagggaatggtgatggccgcaggacctggcgggaaagat
atcttcctgttaagccctgatgacggcgcgaagcctggccaacaggtgaaataa

DBGET integrated database retrieval system