KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_34360Help
Entry
SN31241_34360     CDS       T02779                                 

Definition
(GenBank) aminotransferase YfbQ
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00220  Arginine biosynthesis
senn00250  Alanine, aspartate and glutamate metabolism
senn00290  Valine, leucine and isoleucine biosynthesis
senn01100  Metabolic pathways
senn01110  Biosynthesis of secondary metabolites
senn01130  Biosynthesis of antibiotics
senn01210  2-Oxocarboxylic acid metabolism
senn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:senn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SN31241_34360
   00290 Valine, leucine and isoleucine biosynthesis
    SN31241_34360
   00220 Arginine biosynthesis
    SN31241_34360
Enzymes [BR:senn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SN31241_34360
    2.6.1.66  valine---pyruvate transaminase
     SN31241_34360
Amino acid related enzymes [BR:senn01007]
 Aminotransferase (transaminase)
  Class I
   SN31241_34360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGS30408
Position
3466551..3467765
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVNIAREHNLIIFADEIYDKILYDDAEHHSIAALAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
LPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPRIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPREDDLEMAINRFGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaactcgaaaatgtctgttatgacattcgtggcccc
gttctgaaagaagcgaaacgccttgaggaagaaggtaataaagttcttaaactgaatatc
ggcaaccccgcccccttcggattcgaagcgccggacgaaattctggtcgatgtcattcgt
aatttgccgacggcgcaaggatattgcgactcgaaagggctttattctgcccgtaaagcg
attatgcagcattatcaggcccgtggaatgcgcgatgtaaccgtggaagatatctatatc
ggtaacggcgtttccgagctgatcgttcaggcgatgcaggcgttgcttaacagtggcgat
gaaatgctggttcccgcgcccgattatccgttatggacagcggcggtatcgctctccagc
ggcaaggcggtacattatctttgcgatgaatcttccgactggttcccggaccttgacgat
atccgcgccaaaatcaccccacgtacgcgtggtattgtcattattaatccaaacaaccct
actggcgccgtctattctaaagaattgttgatggaaattgtcaacattgcgcgcgagcat
aatctcatcatcttcgccgatgaaatttatgacaagattctctatgacgatgccgagcat
cactctatcgccgcactggcacctgatctgctgaccatcacctttaatgggttgtctaaa
acctatcgcgtcgccggcttccgccagggctggatggtgctgaacgggccgaaaaaacat
gcgaagggctatattgaagggctggagatgttagcctcaatgcgcctgtgcgccaacgtc
ccggcgcaacatgctattcagaccgcgctcggcggctatcaaagcattagcgaatttatt
ctgccgggcggtcgactgtatgaacagcgtaaccgagcctgggagttgattaacgatatt
cccggcgtttcctgcgtaaaaccgcgcggcgcgttgtacatgttccccaggatcgacgct
aaacgttttaatattcacgacgaccagaagatggtgctggacttcctgctacaggaaaag
gtgctgctggtgcaaggtaccgcctttaactggccgtggccggatcacttccgcattgtg
acgctaccgcgtgaagatgacctggagatggccatcaaccgttttgggcgtttcctctca
ggttaccatcaataa

DBGET integrated database retrieval system