KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_40210Help
Entry
SN31241_40210     CDS       T02779                                 

Definition
(GenBank) 5'/3'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00230  Purine metabolism
senn00240  Pyrimidine metabolism
senn00760  Nicotinate and nicotinamide metabolism
senn01100  Metabolic pathways
senn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SN31241_40210
   00240 Pyrimidine metabolism
    SN31241_40210
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SN31241_40210
Enzymes [BR:senn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     SN31241_40210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AGS30992
Structure
PDB: 

Position
complement(4072337..4073089)
Genome map
AA seq 250 aa AA seqDB search
MLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFDNGDIAV
QMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPALAV
SLNGYQHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDLPLAQVKGIRVTRCGSRHPAD
KVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLTAHSAHDVVSDW
LDSVGVGTQW
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgctgagtaacgatgacggggttcacgcgcccggtatacaaacgctggcgaaagcgctg
cgtgagtttgctgatgtacaggtcgtagccccggatcgtaaccgcagcggcgcgtctaat
tccctcacgctggaatcttcgcttcgtacttttacctttgataatggcgatatcgccgta
cagatggggacgccgaccgattgcgtctatctgggcgttaatgccttaatgcgtccgcgt
ccggatattgtcgtttccggtattaacgcgggtccgaatctgggcgatgatgtgatctat
tccggtactgtcgccgcggcgatggaaggtcgtcatctcggctttccggcattagcggtc
tcccttaacggctatcaacattatgatacggctgcagccgtgacttgcgcgcttttgcga
gggttaagccgggagccgttgcgtaccgggcgtattctcaacgtgaatgtcccggatcta
ccgttagcgcaggttaaaggcatccgcgtgactcgctgtggtagccgccatccagcggat
aaagtaatcccgcaggaagatccgcgcggtaatacattgtactggattggcccgccgggc
gataaatacgatgccgggccggataccgatttcgcggcggtggatgaaggctacgtctcc
gtcacgccgttgcatgtggatttaaccgcgcacagcgcgcatgatgtggtttcagactgg
ttagacagcgtgggagttggcacgcaatggtaa

DBGET integrated database retrieval system