KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_44760Help
Entry
SN31241_44760     CDS       T02779                                 

Definition
(GenBank) Oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00620  Pyruvate metabolism
senn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SN31241_44760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:senn02000]
    SN31241_44760
Enzymes [BR:senn01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SN31241_44760
Transporters [BR:senn02000]
 Other transporters
  Primary active transporters [TC:3]
   SN31241_44760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AGS31447
Position
complement(4527715..4529484)
Genome map
AA seq 589 aa AA seqDB search
MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAQLDDVGYGSLECWGGATFDACIRFLGED
PWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAYELVSEIKKRFEVRLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEGQLKGYDSRILVAQVPGGML
TNLEGQLKQQNAADKLDQVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQARVLEGGAPVTCRPADLLKPELAELEADVKRQAQEK
GIQLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPVPQAEAAQPVAKAEKPAASGIYT
VEVEGKAFVVKVSDGGDISQLTAATPSSAPVQAAAPAGAGTPVTAPLAGNIWKMIATEGQ
TVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGDAVSVGDTLMTLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgactattgccattaccgacgtcgtcctgcgtgacgcccaccagtccctgttcgccacc
cgcctgcgtcttgacgatatgctgccgattgccgctcagctcgacgacgtgggctacggc
tccctcgaatgctggggcggcgccacctttgacgcctgcatccgtttcctcggcgaggac
ccgtggctgcgcctgcgcgaactcaaaaaagccatgcccaaaaccccgctgcagatgctg
ctgcgcggccagaacctgctcggctaccgccactacgccgatgacgtggtggagcgcttc
gtcgaacgcgcggtgaaaaacggcatggacgtgttccgcgtcttcgatgccatgaacgac
ccgcgcaatatgaaagccgccctgcaggcggtgcgcagccacggggcacatgcccagggg
accctgagttacaccaccagcccggcgcacaccctgcagacctggctggatttaacggag
caactgctggaaaccggcgtcgattccatcgccatcaaggatatgtccggcattctcacg
ccgatggcggcgtatgagctggtcagcgaaatcaaaaaacgttttgaggtgcgcctgcat
ctgcactgtcacgccaccaccgggatggcggagatggcgctgctgaaggccattgaagca
ggcgttgacggcgtggacacggcgatttcctccatgagcgccacctacggccacccggcc
accgaggcgctggtggcgacgttggcaggtactgagcacgacaccgggctggatatcctg
aagctggaaaacatcgccgcctacttccgcgaggtgcgcaaaaaataccacgcctttgaa
ggccagctgaaaggctatgacagccgtattctggtggcccaggtgccgggcggaatgctc
actaacctcgaaggccagctgaagcagcagaacgcggcggacaagctggaccaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggctttatcccgctggtgaccccgacctcg
cagattgtcggcacccaggcggtgctcaacgtcctgaccggggaacgctacaaaaccatc
gccaaagaaaccgccggcattctgaaaggcgagtacggccacaccccggtgccggtgaac
gccgcgttacaggcccgcgtgctggaagggggcgctccggtgacctgccgtccggcggat
ttactcaaaccggaactggctgaactggaagcggacgtgaagcgccaggcgcaggagaag
ggcattcagcttgcgggaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcag
attgggctgaaattcctcgaaaaccgccacaacccggcggcgtttgagccggtaccgcag
gcggaagccgcgcagccggtggcaaaagcagagaagcctgccgcttccggtatctacacc
gtggaagtggaaggcaaagcctttgtggtgaaggtcagcgacggcggcgatatcagccag
ctcactgctgccaccccgtcttccgcaccggttcaggctgccgccccggcaggcgcaggc
acaccggtcaccgcgccgctggcgggcaatatctggaagatgattgccaccgagggccag
acggtggccgaaggcgatgtgctgctgattctggaagccatgaagatggaaactgaaatc
cgcgccgcgcaggccgggacggtacgcggtatcgcggtgaagtccggggatgcggtttcc
gtgggcgacaccctgatgacgctggcgtaa

DBGET integrated database retrieval system