KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_07885Help
Entry
AU37_07885        CDS       T03732                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Pathway
seno00250  Alanine, aspartate and glutamate metabolism
seno00650  Butanoate metabolism
seno00760  Nicotinate and nicotinamide metabolism
seno01100  Metabolic pathways
seno01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:seno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AU37_07885
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AU37_07885
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AU37_07885
Enzymes [BR:seno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     AU37_07885
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     AU37_07885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PSD4
Motif
Other DBs
NCBI-ProteinID: AHP73871
Structure
PDB: 

Position
complement(1626720..1628108)
Genome map
AA seq 462 aa AA seqDB search
MTMMTATQALSVNPATGQTLAAMPWANAQEIEHALSLAASGFKKWKMTSVAQRAQTLRDI
GQALRAHAEEMAQCITREMGKPIKQARAEVTKSAALCDWYAEHGPAMLNPEPTLVENQQA
VIEYRPLGVILAIMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQMIARILTEAG
TPAGVYGWVNANNEGVSQMINDPRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTDRFVAAAAALKIGDP
LVEENDLGPMARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVTPDMT
AFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEMAARLECGGVFIN
GYSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKNRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgatgactgcaacacaggcgttatccgttaatcctgcgaccggccagacgctg
gcggcaatgccctgggctaacgcgcaagagattgaacatgcgctgagtctggcggcgagc
ggtttcaaaaagtggaaaatgacatcagtagcgcaacgggcgcaaacattacgcgatatt
ggtcaggcgcttcgcgctcatgcagaagagatggcgcaatgtattacgcgtgaaatgggt
aaacccataaagcaggcgcgtgcggaagtgacgaaatccgccgcgttatgcgactggtat
gcggaacatggcccggcaatgctgaatcctgagcctacgctggtagaaaatcagcaggcg
gtgattgaataccgtccgctgggcgtcattctggcgataatgccgtggaattttccttta
tggcaggtgttacgcggggcagtgccgatactgttggcggggaatagctacttgttaaaa
catgcgcccaatgtcacgggttgcgcgcagatgatagcccgaatcttgacggaagccggt
actcccgctggcgtctatggatgggtgaacgccaataatgagggcgtgagtcagatgatt
aacgatccgcgaatcgcggcggtgacggtgaccggtagcgtgcgcgccggcgcggcgatt
ggcgctcaggctggggcggcgctgaaaaagtgcgtactggaactggggggctcggatccg
tttattgtactcaatgatgccgatctcgagctggcggtaaaagctgcggttgcaggacgc
tatcaaaacaccggacaagtctgcgccgccgccaaacgttttattgtcgaagagggcatt
gcgcaggcgtttaccgatcgttttgtggcggctgccgcagcattaaagataggtgatcct
ctggttgaagagaatgacctggggccgatggcgcgctttgatttgcgtgatgaactccat
caacaggtgcaggcttccgtcgccgaaggcgcacggctactgttgggcggggagaaaatc
gccggggagggcaactattatgccgcgaccgttctggcggatgttacacctgacatgact
gcatttcgtcaggaactttttgggcctgttgccgccattaccgtcgcaaaagatgcggcg
cacgccctcgcgctggcgaatgacagtgagtttggcctgtcggcgacgatctttaccgcc
gacgatacgctggccgcggagatggcggcgcgtcttgagtgcggcggggtattcattaat
gggtacagcgccagcgatgcgcgtgtggcattcggcggggtgaagaaaagtggcttcggt
cgcgagctttcgcactttggtttacacgaattttgtaatgtgcagaccgtctggaagaac
cgcgtctaa

DBGET integrated database retrieval system