KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_11820Help
Entry
AU37_11820        CDS       T03732                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Pathway
seno02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:seno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AU37_11820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:seno02000]
    AU37_11820
Transporters [BR:seno02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AU37_11820
   Histidine transporter
    AU37_11820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 MFS_Mycoplasma
Motif
Other DBs
NCBI-ProteinID: AHP74616
Position
complement(2457688..2458374)
Genome map
AA seq 228 aa AA seqDB search
MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVTGLIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacgggttttcaggcgtaattttacagggcgcgatcgtcacgctggaactggcg
ctcagttccgtggtgctggccgtgcttatcggtctcgtcggcgcgggggcgaagctttcg
caaaaccgggtaacggggcttatttttgaagggtacaccaccctgattcgcggggtgccg
gatctggtattaatgctgctgatattttacggattgcaaatcgcgcttaacgtggtgacc
gattcgctgggtatcgaccagatagatattgatccgatggtggccggtattatcaccctt
ggtttcatctacggcgcctattttaccgaaacctttcgcggcgcgtttatggcggtgccg
aaaggccatatcgaggcggcgacggcttttggttttacccacgggcaaaccttccggcgg
attatgttcccggcgatgatgcgttacgccctgccggggatcggcaataactggcaggtg
atactcaaagcgacggcgctggtgtcgctgctgggcctggaagatgtcgtcaaagccacg
cagcttgccggtaaaagcacctgggagcctttctattttgccgtggtctgtggacttatc
tacctggtatttaccaccgtttccaatggtgtgctgctcttgcttgagcgtcgctattct
gtgggcgtgaagagggccgatttgtga

DBGET integrated database retrieval system